| Basic Information | |
|---|---|
| Taxon OID | 3300027283 Open in IMG/M |
| Scaffold ID | Ga0209643_1057904 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 637 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mt. Terri, Switzerland | |||||||
| Coordinates | Lat. (o) | 47.379 | Long. (o) | 7.1648 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080453 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209643_10579042 | F080453 | N/A | AGPFQTRLWSRLQPAEGDDYFLSSVNFSETKHYVRKVMNSYRRYGEIYEGGPVSGGIPAE |
| ⦗Top⦘ |