NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255065_1050019

Scaffold Ga0255065_1050019


Overview

Basic Information
Taxon OID3300027142 Open in IMG/M
Scaffold IDGa0255065_1050019 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)747
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015208Metagenome / Metatranscriptome256Y
F045755Metagenome / Metatranscriptome152N
F101047Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0255065_10500193F015208GGAMYKLTVANDSEPIHFVREYSDELEAHTEFAKYADWGFADEYSTVNLYTPSGKCYTKLFYREGRRVVVK
Ga0255065_10500194F045755AGGAGMSEIAGMWICDNCDTLAIVSVETDTILVTQCKCITNERETNV
Ga0255065_10500195F101047N/ALYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.