| Basic Information | |
|---|---|
| Family ID | F101047 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGRMKELYTQILECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 72.55 % |
| % of genes near scaffold ends (potentially truncated) | 28.43 % |
| % of genes from short scaffolds (< 2000 bps) | 76.47 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (64.706 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (18.628 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.059 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.941 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 10.42% Coil/Unstructured: 72.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 6.86 |
| PF01464 | SLT | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.24 % |
| Unclassified | root | N/A | 11.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000268|M3P_10171362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300000736|JGI12547J11936_1100529 | Not Available | 521 | Open in IMG/M |
| 3300000756|JGI12421J11937_10169162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300001282|B570J14230_10093346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300002161|JGI24766J26685_10017061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1867 | Open in IMG/M |
| 3300002835|B570J40625_100013477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14526 | Open in IMG/M |
| 3300002835|B570J40625_100017614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12325 | Open in IMG/M |
| 3300003277|JGI25908J49247_10016728 | All Organisms → Viruses → Predicted Viral | 2223 | Open in IMG/M |
| 3300003277|JGI25908J49247_10125743 | Not Available | 606 | Open in IMG/M |
| 3300003404|JGI25920J50251_10093858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300003490|JGI25926J51410_1026135 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
| 3300003493|JGI25923J51411_1045134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300004793|Ga0007760_11183073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300005525|Ga0068877_10767792 | Not Available | 511 | Open in IMG/M |
| 3300005527|Ga0068876_10280192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300005527|Ga0068876_10290947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300005527|Ga0068876_10295681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300005582|Ga0049080_10303687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300005662|Ga0078894_10585096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300005662|Ga0078894_11258192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300005940|Ga0073913_10084759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300006639|Ga0079301_1005843 | All Organisms → Viruses → Predicted Viral | 4969 | Open in IMG/M |
| 3300006805|Ga0075464_10374348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300006875|Ga0075473_10085625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300007544|Ga0102861_1106442 | Not Available | 751 | Open in IMG/M |
| 3300007548|Ga0102877_1037379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
| 3300007549|Ga0102879_1104476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300007549|Ga0102879_1157827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300007551|Ga0102881_1149885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300007597|Ga0102919_1102659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300007617|Ga0102897_1078847 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300007644|Ga0102902_1159381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300007665|Ga0102908_1090724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300007972|Ga0105745_1051612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300007972|Ga0105745_1177855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300008113|Ga0114346_1250761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300008117|Ga0114351_1362149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300008261|Ga0114336_1241319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300008953|Ga0104241_1003058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
| 3300008962|Ga0104242_1035991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
| 3300008996|Ga0102831_1066018 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
| 3300009158|Ga0114977_10491352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300009164|Ga0114975_10031250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3187 | Open in IMG/M |
| 3300009181|Ga0114969_10703387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300009419|Ga0114982_1025408 | All Organisms → Viruses → Predicted Viral | 1944 | Open in IMG/M |
| 3300012017|Ga0153801_1004106 | All Organisms → Viruses → Predicted Viral | 2789 | Open in IMG/M |
| 3300012665|Ga0157210_1012118 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300012779|Ga0138284_1283754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300013014|Ga0164295_11181234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300013372|Ga0177922_10928238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300017701|Ga0181364_1015611 | All Organisms → Viruses → Predicted Viral | 1264 | Open in IMG/M |
| 3300020141|Ga0211732_1049056 | Not Available | 2144 | Open in IMG/M |
| 3300020162|Ga0211735_11152295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300020494|Ga0208326_124909 | Not Available | 533 | Open in IMG/M |
| 3300020498|Ga0208050_1001141 | All Organisms → Viruses → Predicted Viral | 3807 | Open in IMG/M |
| 3300020501|Ga0208590_1015483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300020524|Ga0208858_1019638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300020571|Ga0208723_1037955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300021140|Ga0214168_1021691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1771 | Open in IMG/M |
| 3300021962|Ga0222713_10026874 | All Organisms → Viruses → Predicted Viral | 4713 | Open in IMG/M |
| 3300021962|Ga0222713_10038514 | All Organisms → Viruses → Predicted Viral | 3763 | Open in IMG/M |
| 3300021962|Ga0222713_10195569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1357 | Open in IMG/M |
| 3300021962|Ga0222713_10364521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300021962|Ga0222713_10390348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300021963|Ga0222712_10527650 | Not Available | 693 | Open in IMG/M |
| 3300023174|Ga0214921_10007126 | All Organisms → Viruses | 15016 | Open in IMG/M |
| 3300023174|Ga0214921_10016496 | Not Available | 8305 | Open in IMG/M |
| 3300023174|Ga0214921_10019147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7434 | Open in IMG/M |
| 3300023184|Ga0214919_10253100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1259 | Open in IMG/M |
| 3300024343|Ga0244777_10690188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300024346|Ga0244775_10613256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300024348|Ga0244776_10088885 | All Organisms → Viruses → Predicted Viral | 2330 | Open in IMG/M |
| 3300024348|Ga0244776_10094879 | All Organisms → Viruses → Predicted Viral | 2239 | Open in IMG/M |
| 3300025635|Ga0208147_1000705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11345 | Open in IMG/M |
| 3300027114|Ga0208009_1035274 | Not Available | 1018 | Open in IMG/M |
| 3300027142|Ga0255065_1050019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300027193|Ga0208800_1002706 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
| 3300027217|Ga0208928_1029975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300027222|Ga0208024_1038488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300027231|Ga0208172_1017768 | All Organisms → Viruses → Predicted Viral | 1399 | Open in IMG/M |
| 3300027305|Ga0208168_1029978 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300027366|Ga0208556_1018389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1460 | Open in IMG/M |
| 3300027499|Ga0208788_1000297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25236 | Open in IMG/M |
| 3300027508|Ga0255072_1082811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300027563|Ga0209552_1178228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300027649|Ga0208960_1051134 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
| 3300027710|Ga0209599_10002364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7842 | Open in IMG/M |
| 3300027720|Ga0209617_10001783 | Not Available | 10097 | Open in IMG/M |
| 3300027744|Ga0209355_1024617 | All Organisms → Viruses → Predicted Viral | 3067 | Open in IMG/M |
| 3300027816|Ga0209990_10065187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1822 | Open in IMG/M |
| 3300027969|Ga0209191_1050836 | All Organisms → Viruses → Predicted Viral | 1897 | Open in IMG/M |
| 3300028025|Ga0247723_1015128 | All Organisms → Viruses → Predicted Viral | 2779 | Open in IMG/M |
| 3300031758|Ga0315907_10320363 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300031786|Ga0315908_11227403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300031787|Ga0315900_10486572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
| 3300031857|Ga0315909_10145405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1962 | Open in IMG/M |
| 3300033992|Ga0334992_0057842 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
| 3300034019|Ga0334998_0029524 | Not Available | 3957 | Open in IMG/M |
| 3300034063|Ga0335000_0441866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300034103|Ga0335030_0834302 | Not Available | 537 | Open in IMG/M |
| 3300034110|Ga0335055_0152541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
| 3300034280|Ga0334997_0832758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.90% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.94% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.96% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.98% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.98% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000268 | Lotic microbial communities from Mississippi River at two locations in the state of Minnesota, sample from River Site 1, Mississippi Headwaters ver2 | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007665 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027305 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027366 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3P_101713623 | 3300000268 | Lotic | MGRMKELYTQILDCETCNGKGWVFFGNAKEYDVESCECNPLSFFQENK* |
| JGI12547J11936_11005292 | 3300000736 | Freshwater And Sediment | MSKMKELYTQIFECDTCNGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| JGI12421J11937_101691621 | 3300000756 | Freshwater And Sediment | MVRMKELYTQILECETCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK* |
| B570J14230_100933462 | 3300001282 | Freshwater | MGRMKELYTQILECDTCYGNGWLYYGDENTYDVEACQCNPLSFFQENK* |
| JGI24766J26685_100170612 | 3300002161 | Freshwater And Sediment | MGRMKELYTQILECDTCYGKGWLYYGNEEMFDVEACQCNPLGFFQENK* |
| B570J40625_10001347713 | 3300002835 | Freshwater | MGRMKEIYTQILECETCNGQGWQFFGNQTDYDVEACECNPLGFFQENK* |
| B570J40625_10001761426 | 3300002835 | Freshwater | MGRMKELYTQILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK* |
| JGI25908J49247_100167287 | 3300003277 | Freshwater Lake | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| JGI25908J49247_101257432 | 3300003277 | Freshwater Lake | MGRMKELYTQILECETCNGKGWVFFGNAKDYDVESCECNPLGFFQENK* |
| JGI25920J50251_100938583 | 3300003404 | Freshwater Lake | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGKEN* |
| JGI25926J51410_10261356 | 3300003490 | Freshwater Lake | MGKMKELYTQILECETCYGTGWLYYGDENNYDVEACQCNPLSFFQENK* |
| JGI25923J51411_10451343 | 3300003493 | Freshwater Lake | MSRMKELYTQILECETCNGKGWVFFGNAKEYDVESCECNPLSFFQENK* |
| Ga0007760_111830731 | 3300004793 | Freshwater Lake | MGRMKELYTQILECEACNGQGWQFFGNETDYDVEACDCNPLGFFQE |
| Ga0068877_107677922 | 3300005525 | Freshwater Lake | MGRMKELYTQILECDTCYGKGWLYYGNEEMYDVEACQCNPLGFFQENK* |
| Ga0068876_102801923 | 3300005527 | Freshwater Lake | MGRMKELYTQILECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0068876_102909473 | 3300005527 | Freshwater Lake | MGRMKELYTQILECETCNGQGWQFFGNQTDYDVEACECNPLGFFQENK* |
| Ga0068876_102956813 | 3300005527 | Freshwater Lake | MGRMKEIYTQILECEDCNGQGWLYFGNNENYDVECCNCNPLGFFQENK* |
| Ga0049080_103036871 | 3300005582 | Freshwater Lentic | MVRMKELYTQILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK* |
| Ga0078894_105850964 | 3300005662 | Freshwater Lake | HERKTKMGRMKELYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0078894_112581921 | 3300005662 | Freshwater Lake | MGRMKEIYTQILECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0073913_100847593 | 3300005940 | Sand | MSKMKELYTQIFECDTCYGKGWLYYGDEDNFDVEACQCNPLSFFQENK* |
| Ga0079301_10058434 | 3300006639 | Deep Subsurface | MGRMKELYTQILECDTCYGNGWLYYGDENNYDVEACQCNPLSFFQENK* |
| Ga0075464_103743483 | 3300006805 | Aqueous | MGRMKELYTQIFECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0075473_100856252 | 3300006875 | Aqueous | MGRMKELYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0102861_11064422 | 3300007544 | Estuarine | MKTLEIANCETCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK* |
| Ga0102877_10373794 | 3300007548 | Estuarine | MKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0102879_11044762 | 3300007549 | Estuarine | MGRMKELYTQILECETCNGQGWQFFGNETDYDVKACECNPLGFFQENK* |
| Ga0102879_11578272 | 3300007549 | Estuarine | MKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQE |
| Ga0102881_11498852 | 3300007551 | Estuarine | MGKMKELYTQILECDTCYGTGWLYYGDENNYDVEACQCNPLSFFQENK* |
| Ga0102919_11026592 | 3300007597 | Estuarine | MKELYTQIFECENCNGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0102897_10788472 | 3300007617 | Estuarine | MSKMKELYTQIFECENCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0102902_11593811 | 3300007644 | Estuarine | IMSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0102908_10907241 | 3300007665 | Estuarine | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPIGF |
| Ga0105745_10516124 | 3300007972 | Estuary Water | MKELYTQIFECDICLGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0105745_11778553 | 3300007972 | Estuary Water | SKMKELYTQIFECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0114346_12507613 | 3300008113 | Freshwater, Plankton | MGRMKELYTQILECDTCYGKGWLYYGNEEMYDVEACDCNPLGFFQENK* |
| Ga0114351_13621491 | 3300008117 | Freshwater, Plankton | TKMGRMKELYTQILECETCNGQGWQFFGNQTDYDVEACECNPLGFFQENK* |
| Ga0114336_12413194 | 3300008261 | Freshwater, Plankton | YTQIFECDTCNGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0104241_10030582 | 3300008953 | Freshwater | MGKMKELYTQILECETCWGKGWLYYGDEETYDVCACDCNPLGFFQENK* |
| Ga0104242_10359912 | 3300008962 | Freshwater | MSKMKELYTQILECEACNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0102831_10660183 | 3300008996 | Estuarine | MTKMKELYTQIFECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0114977_104913524 | 3300009158 | Freshwater Lake | MGRMKELYTQILECETCNGKGWVFFGNAKEYDVESCECNPLGFFQENK* |
| Ga0114975_100312502 | 3300009164 | Freshwater Lake | MKELYTQIFECDTCLGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0114969_107033871 | 3300009181 | Freshwater Lake | TQILECETCNGQGWQFFGNETDYDVEACDCNPHGFFQENK* |
| Ga0114982_10254084 | 3300009419 | Deep Subsurface | MKELYTQIFDCETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0153801_10041064 | 3300012017 | Freshwater | MNKMKELYTQILECDTCNGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0157210_10121184 | 3300012665 | Freshwater | MGRMKELYTQILECETCNGKGWVFFGNAKEYDVESCECNPLSFFQENK* |
| Ga0138284_12837543 | 3300012779 | Freshwater Lake | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACDCNPLGFFQENK* |
| Ga0164295_111812343 | 3300013014 | Freshwater | MGRMKELYTQIFECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK* |
| Ga0177922_109282381 | 3300013372 | Freshwater | LYTQILECDTCYGNGWLYYGDENNYDVEACDCNPLGFFQENK* |
| Ga0181364_10156112 | 3300017701 | Freshwater Lake | MNKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0211732_10490563 | 3300020141 | Freshwater | MGRMKEIYTQILECETCNGQGWQFFGNQTDYDVEACECNPLGFFQENK |
| Ga0211735_111522951 | 3300020162 | Freshwater | MGRTKEIYTQILECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0208326_1249092 | 3300020494 | Freshwater | MGRMKELYTQILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK |
| Ga0208050_100114111 | 3300020498 | Freshwater | MGRMKELYTQILECETCNGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0208590_10154834 | 3300020501 | Freshwater | MGRMKELYTQILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQ |
| Ga0208858_10196384 | 3300020524 | Freshwater | ERKTKMGRMKELYTQILECDTCYGNGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0208723_10379551 | 3300020571 | Freshwater | HERKTKMGRMKELYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0214168_10216911 | 3300021140 | Freshwater | ECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0222713_100268749 | 3300021962 | Estuarine Water | MSKMKELYTQIFECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0222713_100385141 | 3300021962 | Estuarine Water | MGRMKELYTQILECDTCYGNGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0222713_101955694 | 3300021962 | Estuarine Water | MGKMKELYTQILECETCWGKGWLYYGDEETYDVCACDCNPLGFFQENK |
| Ga0222713_103645215 | 3300021962 | Estuarine Water | TQILECDTCYGNGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0222713_103903482 | 3300021962 | Estuarine Water | MGKMKELYTQILECETCYGTGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0222712_105276503 | 3300021963 | Estuarine Water | RKTKMGRMKELYTQILECETCYGNGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0214921_1000712617 | 3300023174 | Freshwater | MKELYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0214921_1001649612 | 3300023174 | Freshwater | MKELYTQIFECDTCLGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0214921_1001914716 | 3300023174 | Freshwater | MTKMKELYTQIFECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0214919_102531004 | 3300023184 | Freshwater | TQILECETCWGKGWLYYGDEETYDVCACDCNPLGFFQENK |
| Ga0244777_106901884 | 3300024343 | Estuarine | MGKMKELYTQILECDTCYGTGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0244775_106132563 | 3300024346 | Estuarine | MGRMKELYTQILECETCNGKGWVFFGNAKDYDVESCECNPLGFFQENK |
| Ga0244776_100888852 | 3300024348 | Estuarine | MKELYTQIFECENCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0244776_100948796 | 3300024348 | Estuarine | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0208147_10007057 | 3300025635 | Aqueous | MGRMKELYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0208009_10352741 | 3300027114 | Deep Subsurface | MGRMKEIYTQILECEDCNGQGWLYFGNNENYDVECCNCNPLGFFQENK |
| Ga0255065_10500195 | 3300027142 | Freshwater | LYTQILECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0208800_10027062 | 3300027193 | Estuarine | MGRMKELYTQILECETCNGKGWVFFGNAKEYDVESCECNPLGFFQENK |
| Ga0208928_10299753 | 3300027217 | Estuarine | YTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0208024_10384882 | 3300027222 | Estuarine | MKELYTQIFECENCNGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0208172_10177684 | 3300027231 | Estuarine | MSKMKELYTQIFECENCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0208168_10299783 | 3300027305 | Estuarine | MSKMKELYTQIFECENCNGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0208556_10183896 | 3300027366 | Estuarine | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQ |
| Ga0208788_100029730 | 3300027499 | Deep Subsurface | MKELYTQILECDTCYGNGWLYYGDENNYDVEACQCNPLSFFQENK |
| Ga0255072_10828111 | 3300027508 | Freshwater | MGRMKELYTQILECETCNGQGWVFFGNETDYDVEACECNPLSFFQENK |
| Ga0209552_11782282 | 3300027563 | Freshwater Lake | MSRMKELYTQILECETCNGKGWVFFGNAKEYDVESCECNPLSFFQENK |
| Ga0208960_10511342 | 3300027649 | Freshwater Lentic | MVRMKELYTQILECETCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK |
| Ga0209599_1000236410 | 3300027710 | Deep Subsurface | MTKMKELYTQIFDCETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0209617_1000178325 | 3300027720 | Freshwater And Sediment | MVRMKELYTQILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK |
| Ga0209355_102461712 | 3300027744 | Freshwater Lake | MKELYTQIFECDTCLGQGWQFFGNETDYDVEACECNPLGFFQENK |
| Ga0209990_100651871 | 3300027816 | Freshwater Lake | SKHERKTKMGRMKELYTQILECETCNGQGWQFFGNQTDYDVEACECNPLGFFQENK |
| Ga0209191_10508367 | 3300027969 | Freshwater Lake | MSKMKELYTQIFECDTCLGQGWQFFGNETDYDVEACDCNP |
| Ga0247723_10151284 | 3300028025 | Deep Subsurface Sediment | MKELYTQIFDCETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0315907_103203633 | 3300031758 | Freshwater | MGRMKELYTQILECDTCYGKGWLYYGNEEMYDVEACQCNPLGFFQENK |
| Ga0315908_112274033 | 3300031786 | Freshwater | YTQILECDTCYGKGWLYYGNEEMYDVEACQCNPLGFFQENK |
| Ga0315900_104865723 | 3300031787 | Freshwater | MGRMKELYTQILECETCNGQGWQFFGNQTDYDVEACECNPLGFFQENK |
| Ga0315909_101454056 | 3300031857 | Freshwater | ILECDTCYGKGWLYYGNEEMFDVEACQCNPLGFFQENK |
| Ga0334992_0057842_76_222 | 3300033992 | Freshwater | MGRMKELYTQILECDTCYGNGWLYYGDENTYDVEACQCNPLSFFQENK |
| Ga0334998_0029524_3645_3791 | 3300034019 | Freshwater | MGRMKELYTQILECDTCYGNGWLYYGDENNYDVEACDCNPLGFFQENK |
| Ga0335000_0441866_3_119 | 3300034063 | Freshwater | ILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK |
| Ga0335030_0834302_372_536 | 3300034103 | Freshwater | NERKTKMGRMKELYTQILECETCYGNGWLYYGDENTYDVEACQCNPLSFFQENK |
| Ga0335055_0152541_926_1039 | 3300034110 | Freshwater | LECETCNGQGWQFFGNETDYDVEACDCNPLGFFQENK |
| Ga0334997_0832758_418_552 | 3300034280 | Freshwater | KELYTQILECDTCYGKGWLYYGDEDNYDVEACQCNPLSFFQENK |
| ⦗Top⦘ |