| Basic Information | |
|---|---|
| Family ID | F045755 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 152 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSEIAGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNV |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 152 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 71.05 % |
| % of genes near scaffold ends (potentially truncated) | 40.13 % |
| % of genes from short scaffolds (< 2000 bps) | 69.74 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (59.868 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (20.395 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.895 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.447 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 47.62% Coil/Unstructured: 52.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 152 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 5.26 |
| PF03796 | DnaB_C | 0.66 |
| PF13392 | HNH_3 | 0.66 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.66 |
| PF09834 | DUF2061 | 0.66 |
| PF03567 | Sulfotransfer_2 | 0.66 |
| PF01844 | HNH | 0.66 |
| PF00685 | Sulfotransfer_1 | 0.66 |
| PF04860 | Phage_portal | 0.66 |
| COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.66 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.66 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.92 % |
| Unclassified | root | N/A | 19.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10019815 | All Organisms → Viruses → Predicted Viral | 2488 | Open in IMG/M |
| 3300000756|JGI12421J11937_10169162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300000882|FwDRAFT_10037779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4488 | Open in IMG/M |
| 3300001282|B570J14230_10058398 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
| 3300001282|B570J14230_10161924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300002408|B570J29032_109392289 | Not Available | 732 | Open in IMG/M |
| 3300002835|B570J40625_100013477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14526 | Open in IMG/M |
| 3300003277|JGI25908J49247_10125743 | Not Available | 606 | Open in IMG/M |
| 3300003430|JGI25921J50272_10006841 | All Organisms → Viruses → Predicted Viral | 3511 | Open in IMG/M |
| 3300003491|JGI25924J51412_1075127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300004124|Ga0066178_10114566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300004769|Ga0007748_11633043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300004836|Ga0007759_10307337 | Not Available | 934 | Open in IMG/M |
| 3300005517|Ga0070374_10402948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300005528|Ga0068872_10073638 | All Organisms → Viruses → Predicted Viral | 2083 | Open in IMG/M |
| 3300005580|Ga0049083_10023378 | All Organisms → Viruses → Predicted Viral | 2224 | Open in IMG/M |
| 3300005580|Ga0049083_10210407 | Not Available | 659 | Open in IMG/M |
| 3300005580|Ga0049083_10242739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300005584|Ga0049082_10074277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1193 | Open in IMG/M |
| 3300005584|Ga0049082_10283963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300005662|Ga0078894_10854361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300005662|Ga0078894_11222871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300005662|Ga0078894_11785327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300006484|Ga0070744_10022473 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300006875|Ga0075473_10085625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300006875|Ga0075473_10399287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300007363|Ga0075458_10000776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10461 | Open in IMG/M |
| 3300007549|Ga0102879_1014780 | Not Available | 2657 | Open in IMG/M |
| 3300007549|Ga0102879_1212516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300007560|Ga0102913_1190635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300007593|Ga0102918_1236361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300007600|Ga0102920_1222583 | Not Available | 607 | Open in IMG/M |
| 3300007606|Ga0102923_1056550 | Not Available | 1232 | Open in IMG/M |
| 3300007620|Ga0102871_1042334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1350 | Open in IMG/M |
| 3300007621|Ga0102872_1096664 | Not Available | 793 | Open in IMG/M |
| 3300007621|Ga0102872_1104766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| 3300007627|Ga0102869_1153146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300007658|Ga0102898_1089576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
| 3300007706|Ga0102899_1161993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300007716|Ga0102867_1010621 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
| 3300007972|Ga0105745_1051612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300007973|Ga0105746_1204332 | Not Available | 675 | Open in IMG/M |
| 3300007992|Ga0105748_10176695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300008052|Ga0102893_1167785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300008110|Ga0114343_1058668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1455 | Open in IMG/M |
| 3300008258|Ga0114840_1016648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
| 3300008261|Ga0114336_1083685 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
| 3300008996|Ga0102831_1066018 | All Organisms → Viruses → Predicted Viral | 1208 | Open in IMG/M |
| 3300009051|Ga0102864_1076922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
| 3300009068|Ga0114973_10382053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300009152|Ga0114980_10047648 | Not Available | 2606 | Open in IMG/M |
| 3300009152|Ga0114980_10052152 | All Organisms → Viruses → Predicted Viral | 2479 | Open in IMG/M |
| 3300009152|Ga0114980_10189255 | Not Available | 1213 | Open in IMG/M |
| 3300009158|Ga0114977_10108984 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
| 3300009158|Ga0114977_10491352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300009158|Ga0114977_10584741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300009159|Ga0114978_10728720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300009160|Ga0114981_10000890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19725 | Open in IMG/M |
| 3300009160|Ga0114981_10337354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300009164|Ga0114975_10000038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 88352 | Open in IMG/M |
| 3300009180|Ga0114979_10722880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300009183|Ga0114974_10383315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300009187|Ga0114972_10279847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300009419|Ga0114982_1000061 | Not Available | 54120 | Open in IMG/M |
| 3300009419|Ga0114982_1025408 | All Organisms → Viruses → Predicted Viral | 1944 | Open in IMG/M |
| 3300010160|Ga0114967_10034223 | All Organisms → Viruses → Predicted Viral | 3366 | Open in IMG/M |
| 3300011268|Ga0151620_1028011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
| 3300012663|Ga0157203_1001153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6659 | Open in IMG/M |
| 3300012663|Ga0157203_1042821 | Not Available | 618 | Open in IMG/M |
| 3300012665|Ga0157210_1008735 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300012725|Ga0157610_1074027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300012763|Ga0138289_1222235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300012773|Ga0138290_1288747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300012779|Ga0138284_1091933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300013005|Ga0164292_10097596 | All Organisms → Viruses → Predicted Viral | 2219 | Open in IMG/M |
| 3300013295|Ga0170791_10105851 | Not Available | 579 | Open in IMG/M |
| 3300013295|Ga0170791_12031058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300013295|Ga0170791_14093296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
| 3300014050|Ga0119952_1017462 | All Organisms → Viruses → Predicted Viral | 2509 | Open in IMG/M |
| 3300017761|Ga0181356_1224273 | Not Available | 546 | Open in IMG/M |
| 3300017766|Ga0181343_1049370 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300019784|Ga0181359_1109177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300020141|Ga0211732_1049056 | Not Available | 2144 | Open in IMG/M |
| 3300020141|Ga0211732_1372540 | Not Available | 5291 | Open in IMG/M |
| 3300020155|Ga0194050_1123522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300020160|Ga0211733_10019121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300020160|Ga0211733_10615822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1359 | Open in IMG/M |
| 3300020162|Ga0211735_10439473 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300020483|Ga0207418_100326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8933 | Open in IMG/M |
| 3300020519|Ga0208223_1005388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2293 | Open in IMG/M |
| 3300020560|Ga0208852_1000882 | Not Available | 8055 | Open in IMG/M |
| 3300021602|Ga0194060_10175486 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300021962|Ga0222713_10289253 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300021963|Ga0222712_10041013 | All Organisms → Viruses → Predicted Viral | 3539 | Open in IMG/M |
| 3300022407|Ga0181351_1225979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300022752|Ga0214917_10006047 | Not Available | 12715 | Open in IMG/M |
| 3300022752|Ga0214917_10012925 | Not Available | 7515 | Open in IMG/M |
| 3300023174|Ga0214921_10007126 | All Organisms → Viruses | 15016 | Open in IMG/M |
| 3300023174|Ga0214921_10019147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7434 | Open in IMG/M |
| 3300023184|Ga0214919_10000994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 47901 | Open in IMG/M |
| 3300024343|Ga0244777_10164921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1428 | Open in IMG/M |
| 3300024346|Ga0244775_10103306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2422 | Open in IMG/M |
| 3300024348|Ga0244776_10579111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300025635|Ga0208147_1000705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11345 | Open in IMG/M |
| 3300025732|Ga0208784_1215912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300026425|Ga0256300_1039018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300027084|Ga0208443_1092209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300027132|Ga0255110_1038293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300027142|Ga0255065_1050019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300027205|Ga0208926_1002370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2736 | Open in IMG/M |
| 3300027225|Ga0208025_1020680 | Not Available | 1157 | Open in IMG/M |
| 3300027241|Ga0208805_1087188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300027244|Ga0208173_1027311 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300027285|Ga0255131_1034073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300027294|Ga0208441_1045713 | Not Available | 990 | Open in IMG/M |
| 3300027294|Ga0208441_1098403 | Not Available | 579 | Open in IMG/M |
| 3300027387|Ga0208311_1003263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4288 | Open in IMG/M |
| 3300027581|Ga0209651_1192693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300027621|Ga0208951_1082844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300027631|Ga0208133_1003264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5114 | Open in IMG/M |
| 3300027644|Ga0209356_1156526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300027656|Ga0209357_1112189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300027688|Ga0209553_1218466 | Not Available | 611 | Open in IMG/M |
| 3300027689|Ga0209551_1063609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
| 3300027689|Ga0209551_1115808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027710|Ga0209599_10000780 | Not Available | 18129 | Open in IMG/M |
| 3300027710|Ga0209599_10002364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7842 | Open in IMG/M |
| 3300027732|Ga0209442_1097514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
| 3300027733|Ga0209297_1095555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
| 3300027734|Ga0209087_1000716 | Not Available | 20648 | Open in IMG/M |
| 3300027734|Ga0209087_1002688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9931 | Open in IMG/M |
| 3300027734|Ga0209087_1091750 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300027744|Ga0209355_1223765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300027759|Ga0209296_1093593 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300027760|Ga0209598_10171234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300027760|Ga0209598_10193073 | Not Available | 866 | Open in IMG/M |
| 3300027763|Ga0209088_10069676 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300027769|Ga0209770_10021341 | All Organisms → Viruses → Predicted Viral | 2850 | Open in IMG/M |
| 3300027769|Ga0209770_10051193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1752 | Open in IMG/M |
| 3300027770|Ga0209086_10025718 | All Organisms → Viruses → Predicted Viral | 3596 | Open in IMG/M |
| 3300027770|Ga0209086_10034218 | All Organisms → Viruses → Predicted Viral | 2997 | Open in IMG/M |
| 3300027782|Ga0209500_10042396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2486 | Open in IMG/M |
| 3300027782|Ga0209500_10151509 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300027797|Ga0209107_10551697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300027816|Ga0209990_10399634 | Not Available | 597 | Open in IMG/M |
| 3300028394|Ga0304730_1235579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300033816|Ga0334980_0045144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1870 | Open in IMG/M |
| 3300034021|Ga0335004_0044405 | All Organisms → Viruses → Predicted Viral | 3139 | Open in IMG/M |
| 3300034060|Ga0334983_0065444 | All Organisms → Viruses → Predicted Viral | 2363 | Open in IMG/M |
| 3300034082|Ga0335020_0004595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8934 | Open in IMG/M |
| 3300034102|Ga0335029_0003158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13083 | Open in IMG/M |
| 3300034117|Ga0335033_0621879 | Not Available | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.11% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 17.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.95% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.29% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.63% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.63% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.97% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.97% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.97% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.97% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.32% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.66% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.66% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020155 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10m | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020483 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027225 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027241 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027294 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027387 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_1001981510 | 3300000756 | Freshwater And Sediment | MSEIAGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNV* |
| JGI12421J11937_101691622 | 3300000756 | Freshwater And Sediment | MSEIAGMWICDNCDTLAIVSVETDTILITQCKCITNERETNV* |
| FwDRAFT_1003777915 | 3300000882 | Freshwater And Marine | MNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKIK* |
| B570J14230_100583983 | 3300001282 | Freshwater | MQQIAGMWICDNCDTLAIVSVGTDTINITQCQCVQLSKTNN* |
| B570J14230_101619241 | 3300001282 | Freshwater | IAGMWICDNCDTLAVVSVLTDTIVITQCKCITNERETNV* |
| B570J29032_1093922891 | 3300002408 | Freshwater | MEQIAGMWICDNCNTLAIVSVGTDTLHITQCQCVQLSKTNN* |
| B570J40625_10001347712 | 3300002835 | Freshwater | MSEIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETNV* |
| JGI25908J49247_101257431 | 3300003277 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| JGI25921J50272_1000684111 | 3300003430 | Freshwater Lake | MKSQSEIAGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNV* |
| JGI25924J51412_10751272 | 3300003491 | Freshwater Lake | MKSQSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0066178_101145662 | 3300004124 | Freshwater Lake | MNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTDERDTNE* |
| Ga0007748_116330433 | 3300004769 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTIQITQCKCVTNERETNV* |
| Ga0007759_103073376 | 3300004836 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERET |
| Ga0070374_104029482 | 3300005517 | Freshwater Lake | MLGGITMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTDERNTNE* |
| Ga0068872_100736389 | 3300005528 | Freshwater Lake | MSEIAGMWICDNCDTLATVSVLTDTIQITQCKCVSNERETNV* |
| Ga0049083_100233788 | 3300005580 | Freshwater Lentic | MSEIAEMWICDKCDTLAIVSVETDTILITQCKCVTNERETNV* |
| Ga0049083_102104074 | 3300005580 | Freshwater Lentic | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCITNERETNV* |
| Ga0049083_102427392 | 3300005580 | Freshwater Lentic | MSEIAGMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0049082_100742772 | 3300005584 | Freshwater Lentic | MKSQSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTKERETNV* |
| Ga0049082_102839631 | 3300005584 | Freshwater Lentic | ICDKCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0078894_108543613 | 3300005662 | Freshwater Lake | MNQIAGMWICDNCDTLAIVSVATDTIVIQQCECVTNERETNV* |
| Ga0078894_112228711 | 3300005662 | Freshwater Lake | IAGMWICDNCDTLAIVSVLTDTIQITQCKCVSNERETNV* |
| Ga0078894_117853271 | 3300005662 | Freshwater Lake | MSEIAGMWICDNCDTLAVVSVETDTIQITQCKCVTNERETNV* |
| Ga0070744_100224733 | 3300006484 | Estuarine | MTQVAGMWICDNCDTLAIVSVATDTIVITQCKCVTNERETNV* |
| Ga0075473_100856251 | 3300006875 | Aqueous | MSEIAGMWICDNCDTLATVSVATDTIVIQQCECVTNERETNV* |
| Ga0075473_103992871 | 3300006875 | Aqueous | MWICDNCDTLAVVSVETDTIQITQCKCVTNERETNV* |
| Ga0075458_1000077617 | 3300007363 | Aqueous | MSKIAGMWICDNCDTLAVVSVETDTIQITQCKCVTNERETNV* |
| Ga0102879_10147801 | 3300007549 | Estuarine | NCFMRKVLVIMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKIK* |
| Ga0102879_12125161 | 3300007549 | Estuarine | EIAGMWICDNCDTLAIVSVETDTILVTQCKCITNERETNV* |
| Ga0102913_11906351 | 3300007560 | Estuarine | LMSEIAGMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0102918_12363614 | 3300007593 | Estuarine | MNEITGMWICDNCNTLATVSFDNDTLVIAQCECVTNE |
| Ga0102920_12225833 | 3300007600 | Estuarine | MRKVLVIMNQIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNER |
| Ga0102923_10565505 | 3300007606 | Estuarine | MRKVLVIMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKIK* |
| Ga0102871_10423341 | 3300007620 | Estuarine | RGKLLMSEIAGMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0102872_10966641 | 3300007621 | Estuarine | MSEIAGMWICDKCDTLAIVSVETDTILITQCKCVTNERETNE* |
| Ga0102872_11047663 | 3300007621 | Estuarine | MTQIAGMWICDNCDTLAVVSVLTDTIAIQQCKCVTNERETNV* |
| Ga0102869_11531462 | 3300007627 | Estuarine | KQIHLRRMLGVLIMNQIAGMWICDNCDTLAIVSVETDTILVTQCKCVTDERNANE* |
| Ga0102898_10895763 | 3300007658 | Estuarine | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCITNERET |
| Ga0102899_11619931 | 3300007706 | Estuarine | GMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0102867_10106212 | 3300007716 | Estuarine | MSEIAGMWICDNCDTLAIVSVETDTILVTQCECVSKERNK* |
| Ga0105745_10516125 | 3300007972 | Estuary Water | MSEIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKIK |
| Ga0105746_12043321 | 3300007973 | Estuary Water | EIAGMWICDKCDTLAIVSVETDTILVTQCECVSKERNK* |
| Ga0105748_101766951 | 3300007992 | Estuary Water | LMSEIAGMWICDKCDTLGIVSVETDTILVTQCKCITNERETNV* |
| Ga0102893_11677853 | 3300008052 | Estuarine | MRKVLVIMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKI |
| Ga0114343_10586685 | 3300008110 | Freshwater, Plankton | MSEIAGMWICDNCDTLAVVSVLTDTIVITQCKCITNERETNV* |
| Ga0114840_10166482 | 3300008258 | Freshwater, Plankton | MSEIAGMWICDNCDTLAIVSVLTDTIQITQCKCVSNERETNV* |
| Ga0114336_10836851 | 3300008261 | Freshwater, Plankton | MNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTDERNTNE* |
| Ga0102831_10660184 | 3300008996 | Estuarine | MSEIAGMWICDNCDTLAIVSVATDTIVIQQCECVTKERETNV* |
| Ga0102864_10769222 | 3300009051 | Estuarine | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCITNER |
| Ga0114973_103820532 | 3300009068 | Freshwater Lake | MSEIAGMWICDNCNTLAIVSVETDTILVTQCKCVTKERETNE* |
| Ga0114980_100476485 | 3300009152 | Freshwater Lake | MSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVTNERETNE* |
| Ga0114980_100521521 | 3300009152 | Freshwater Lake | MKSQSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0114980_101892554 | 3300009152 | Freshwater Lake | MKSQSEIAGMWICSNCNTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0114977_101089848 | 3300009158 | Freshwater Lake | MSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVT |
| Ga0114977_104913523 | 3300009158 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTIQITQCECVKKERETK* |
| Ga0114977_105847414 | 3300009158 | Freshwater Lake | SEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0114978_107287203 | 3300009159 | Freshwater Lake | MSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0114981_1000089034 | 3300009160 | Freshwater Lake | MKSQSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVTN |
| Ga0114981_103373541 | 3300009160 | Freshwater Lake | KSQSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0114975_100000385 | 3300009164 | Freshwater Lake | MRKVLVIMNQIAGMWICDNCNTLAIVSVETDTILVTQCKCVTDERNTNE* |
| Ga0114979_107228801 | 3300009180 | Freshwater Lake | MSEIAGMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNE* |
| Ga0114974_103833154 | 3300009183 | Freshwater Lake | WICDNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0114972_102798473 | 3300009187 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTKERETNE* |
| Ga0114982_100006197 | 3300009419 | Deep Subsurface | MSQIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETNV* |
| Ga0114982_10254083 | 3300009419 | Deep Subsurface | MNQIAGMWICDNCDTLAVVSVLTDTIAIQQCKCVTNERETNV* |
| Ga0114967_1003422311 | 3300010160 | Freshwater Lake | MSEIAGMWICDKCYTLAIVSVLTDTIAIQQCKCVTNERENLNG* |
| Ga0151620_10280115 | 3300011268 | Freshwater | MKIAEMWICDNCDTLAIVSVATDTIVITQCKCITNERENLNV* |
| Ga0157203_10011539 | 3300012663 | Freshwater | MSEIAGMWICDNCDTLAIVSVLTDTIQITQCKCVTNERETNV* |
| Ga0157203_10428211 | 3300012663 | Freshwater | MSEIAGMWICDNCDTLAIVSVLTDTIQITQCKCVTNERET |
| Ga0157210_10087355 | 3300012665 | Freshwater | MNEIAGMWICDNCDTLAIVSVATDTIVIQQCECVTNERETNV* |
| Ga0157610_10740273 | 3300012725 | Freshwater | AEMWICDNCDTLAIVSVATDTIVITQCKCITNERETNV* |
| Ga0138289_12222354 | 3300012763 | Freshwater Lake | MSEIAGMWICDNCDTLAIASVETDTILVTQCKCVTN |
| Ga0138290_12887471 | 3300012773 | Freshwater Lake | MSEIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETK* |
| Ga0138284_10919334 | 3300012779 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNE* |
| Ga0164292_100975967 | 3300013005 | Freshwater | MKIAEMWICDNCDTLAIVSVATDTIVITQCKCITNERETNV* |
| Ga0170791_101058511 | 3300013295 | Freshwater | IAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV* |
| Ga0170791_120310581 | 3300013295 | Freshwater | IAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNE* |
| Ga0170791_140932961 | 3300013295 | Freshwater | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNE |
| Ga0119952_101746210 | 3300014050 | Freshwater | MSEIAGMWICDNCDTLATVSVETDTILITQCKCVTNERETNV* |
| Ga0181356_12242734 | 3300017761 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETETILITQCKCVTKERET |
| Ga0181343_10493704 | 3300017766 | Freshwater Lake | MKSQSEIAGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNV |
| Ga0181359_11091774 | 3300019784 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0211732_10490562 | 3300020141 | Freshwater | MSEIAGMWICDNCDTLAVVSVLTDTIAIQQCKCVSNERETNV |
| Ga0211732_13725407 | 3300020141 | Freshwater | MQQIAGMWICDNCDTLAIVSVGTDTLNITQCQCVQLSKTNN |
| Ga0194050_11235224 | 3300020155 | Anoxic Zone Freshwater | GICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0211733_100191213 | 3300020160 | Freshwater | MSEITGMWICDNCDTLAVVSVETDTIVIQQCKCVTNERETNV |
| Ga0211733_106158225 | 3300020160 | Freshwater | WICDNCDTLAVVSVLTDTIQITQCKCITNERENLNV |
| Ga0211735_104394733 | 3300020162 | Freshwater | MSEIAGMWICDNCDTLAVVSVLTDTIAIQQCKCVTNERETNV |
| Ga0207418_1003266 | 3300020483 | Freshwater | MSEIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETNV |
| Ga0208223_10053882 | 3300020519 | Freshwater | MSNIAGMWICDNCDTLAVVSVLTDTIVITQCKCITNERETNV |
| Ga0208852_100088221 | 3300020560 | Freshwater | MQQIAGMWICDNCDTLAIVSVGTDTINITQCQCVQLSKTNN |
| Ga0194060_101754863 | 3300021602 | Anoxic Zone Freshwater | MSEIAGMWICDNCDTLAVVSVETDTILVTQCKCVTNERETNV |
| Ga0222713_102892533 | 3300021962 | Estuarine Water | MSEIAGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNE |
| Ga0222712_100410136 | 3300021963 | Estuarine Water | MNEISGMWICDNCDTLAVVSVLTDTIAIQQCKCVTNERENLNV |
| Ga0181351_12259792 | 3300022407 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNET |
| Ga0214917_1000604730 | 3300022752 | Freshwater | MSEIAGMWICDNCNTLAIVSVLTDTIQITQCECVTKERETK |
| Ga0214917_1001292518 | 3300022752 | Freshwater | MSEIAGMWICDNCDTLAVVSVLTDTIAIQQCKCVNDERETNV |
| Ga0214921_1000712618 | 3300023174 | Freshwater | MSEIAGMWICDNCDTLAIVSVATDTIVIQQCECVTKERETNV |
| Ga0214921_1001914717 | 3300023174 | Freshwater | MSKITGMWICDNCDTLAIVSVATDTIVIQQCKCVTNERETNV |
| Ga0214919_1000099430 | 3300023184 | Freshwater | MSEIAGMWICSNCDTLAVVSVLTDTIAIQQCKCVTDERETNV |
| Ga0244777_101649212 | 3300024343 | Estuarine | MNEITGMWICDNCNTLATVSFDNDTLVIAQCECVTNERKINE |
| Ga0244775_101033066 | 3300024346 | Estuarine | MTQVAGMWICDNCDTLAIVSVATDTIVITQCKCVTNERETNV |
| Ga0244776_105791111 | 3300024348 | Estuarine | KLLMSEIAGMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0208147_10007058 | 3300025635 | Aqueous | MSKIAGMWICDNCDTLAVVSVETDTIQITQCKCVTNERETNV |
| Ga0208784_12159124 | 3300025732 | Aqueous | MWICDNCDTLAVVSVETDTIQITQCKCVTNERETNV |
| Ga0256300_10390182 | 3300026425 | Freshwater | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCLTNERETNV |
| Ga0208443_10922091 | 3300027084 | Estuarine | MWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0255110_10382933 | 3300027132 | Freshwater | WICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0255065_10500194 | 3300027142 | Freshwater | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCITNERETNV |
| Ga0208926_10023706 | 3300027205 | Estuarine | MSEIAGMWICDKCDTLAIVSVETDTILVTQCKCITNERETNV |
| Ga0208025_10206806 | 3300027225 | Estuarine | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERE |
| Ga0208805_10871881 | 3300027241 | Estuarine | MRKVLVIMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTK |
| Ga0208173_10273114 | 3300027244 | Estuarine | MRKVLVIMNQIAGMWICDNCNTLATVSVAIDTLVI |
| Ga0255131_10340731 | 3300027285 | Freshwater | MSEIAGMWICDNCDTLAIVSVETDTIQITQCKCVTNERET |
| Ga0208441_10457131 | 3300027294 | Estuarine | RKVLVIMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKIK |
| Ga0208441_10984032 | 3300027294 | Estuarine | MNQIAGMWICDNCDTLAIVSVETDTILVTQCKCVTDERNT |
| Ga0208311_10032636 | 3300027387 | Estuarine | MNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTKNKIK |
| Ga0209651_11926931 | 3300027581 | Freshwater Lake | MWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0208951_10828445 | 3300027621 | Freshwater Lentic | MSEIAGMWICDKCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0208133_10032641 | 3300027631 | Estuarine | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETN |
| Ga0209356_11565263 | 3300027644 | Freshwater Lake | GMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0209357_11121893 | 3300027656 | Freshwater Lake | IAGMWICDNCDTLAIVSVETDTILVTQCKCVTKERETNV |
| Ga0209553_12184663 | 3300027688 | Freshwater Lake | AGMWICDNCDTLAIVSVATDTIVITQCKCITNERETNV |
| Ga0209551_10636091 | 3300027689 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNER |
| Ga0209551_11158081 | 3300027689 | Freshwater Lake | MLGGITMNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTDERDTNE |
| Ga0209599_1000078022 | 3300027710 | Deep Subsurface | MSQIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETNV |
| Ga0209599_100023649 | 3300027710 | Deep Subsurface | MNQIAGMWICDNCDTLAVVSVLTDTIAIQQCKCVTNERETNV |
| Ga0209442_10975144 | 3300027732 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCIT |
| Ga0209297_10955553 | 3300027733 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTIQITQCECVKKERETK |
| Ga0209087_10007164 | 3300027734 | Freshwater Lake | MKSQSEIAGMWICSNCNTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0209087_100268823 | 3300027734 | Freshwater Lake | MSEIAGMWICSNCDTLAIVSVETDTILVTQCKCVTNERETNE |
| Ga0209087_10917506 | 3300027734 | Freshwater Lake | MRKVLVIMNQIAGMWICDNCNTLAIVSVETDTILVTQCKCV |
| Ga0209355_12237651 | 3300027744 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVATDTIVITQCKCITNERETNV |
| Ga0209296_10935931 | 3300027759 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNE |
| Ga0209598_101712345 | 3300027760 | Freshwater Lake | MSEIAGMWICDNCNTLAIVSVETDTILVTQCKCVTKERETNE |
| Ga0209598_101930733 | 3300027760 | Freshwater Lake | MKSQSEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0209088_100696764 | 3300027763 | Freshwater Lake | MSEIAGMWICDKCDTLAIVSVLTDTIQITQCKCVTNERETNE |
| Ga0209770_100213417 | 3300027769 | Freshwater Lake | MNQIAGMWICDNCNTLATVSVAIDTLVIEQCKCVTDERNTNE |
| Ga0209770_100511934 | 3300027769 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVLTDTIQITQCKCVSNERETNV |
| Ga0209086_100257184 | 3300027770 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNV |
| Ga0209086_100342187 | 3300027770 | Freshwater Lake | MSEIAGMWICDKCDTLAIVSVLTDTIAIQQCKCVTNERENLNG |
| Ga0209500_100423961 | 3300027782 | Freshwater Lake | SEIAGMWICDNCDTLAIVSVETDTILVTQCKCVTNERETNV |
| Ga0209500_101515093 | 3300027782 | Freshwater Lake | MSEIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETK |
| Ga0209107_105516971 | 3300027797 | Freshwater And Sediment | AEMWICDNCDTLAIVSVATDTIVITQCKCITNERENLNV |
| Ga0209990_103996341 | 3300027816 | Freshwater Lake | MSEIAGMWICDNCDTLAIVSVETDTIQITQCKCVTN |
| Ga0304730_12355794 | 3300028394 | Freshwater Lake | AGMWICDNCDTLAIVSVETDTILITQCKCVTNERETNV |
| Ga0334980_0045144_238_363 | 3300033816 | Freshwater | MKIAEMWICDNCDTLAIVSVATDTIVITQCKCITNERETNV |
| Ga0335004_0044405_3_116 | 3300034021 | Freshwater | MWICDNCDTLAIVSVATDTIVITQCKCITNERENLNV |
| Ga0334983_0065444_1_126 | 3300034060 | Freshwater | MSEIAGMWICDNCDTLAVVSVETDTILITQCKCITNERETNV |
| Ga0335020_0004595_6439_6567 | 3300034082 | Freshwater | MKIAEMWICDNCDTLAIVSVATDTIVITQCKCITNERENLNV |
| Ga0335029_0003158_2313_2441 | 3300034102 | Freshwater | MSEIAGMWICDNCDTLAIVSVATDTIVIQQCECVTNERETNV |
| Ga0335033_0621879_376_498 | 3300034117 | Freshwater | MSEIAGMWICDNCDTLAVVSVLTDTIQITQCKCVTNERETN |
| ⦗Top⦘ |