NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256913_10571156

Scaffold Ga0256913_10571156


Overview

Basic Information
Taxon OID3300026546 Open in IMG/M
Scaffold IDGa0256913_10571156 Open in IMG/M
Source Dataset NameDeep-sea worm associated microbial mat communities from Axial Seamount, Juan de Fuca Ridge, Pacific Ocean - Axial_Mat
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)578
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Candidatus Electrothrix → Candidatus Electrothrix marina(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Deep-Sea Worm Associated Microbial Mat → Marine Microbial Communities From Hydrothermal Vents In The Atlantic And Pacific Ocean

Source Dataset Sampling Location
Location NamePacific Ocean: Juan de Fuca Ridge
CoordinatesLat. (o)45.9333Long. (o)-130.0138Alt. (m)Depth (m)1200
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036294Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0256913_105711561F036294N/AMDRGSSDEAIVGVKPVADEDAVTYLRVKLSESDKEVGAEGWNM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.