Scaffold Ga0208832_115863

Overview

Basic Information

• Taxon OID: 3300025184
• Scaffold ID: Ga0208832_115863
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP2158 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 525
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Southwest of Acapulco, Mexico, North Pacific Ocean
• Coordinates
  • Lat. (^o): 12.0
  • Long. (^o): -108.06
  • Depth (m): 3103.11

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066126	Metagenome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208832_1158632	F066126	N/A	KNFPKNKANLGGINSVGIAIKNTKTIPIYKKRLNNNDLISNI