Scaffold Ga0209959_100058

Overview

Basic Information

• Taxon OID: 3300024973
• Scaffold ID: Ga0209959_100058
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_300_biof (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 259641
• Total Scaffold Genes: 274
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 199 (72.63%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.936637
  • Long. (^o): 18.478905

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209959_100058106	F025775	GGAG	MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF