Scaffold Ga0256752_1051147

Overview

Basic Information

• Taxon OID: 3300023439
• Scaffold ID: Ga0256752_1051147
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 947
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: International: TAG Site, Mid-Atlantic Ridge
• Coordinates
  • Lat. (^o): 26.137196
  • Long. (^o): -44.826442
  • Depth (m): 3626.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082766	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256752_10511471	F082766	N/A	VLFNLAVPLYCPTEDSEHNLYAISTNGDVYQVTEGQMEVAFQTGGQPTALIFDSQGSSFIADQAHQAIMS