NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256628_107627

Scaffold Ga0256628_107627


Overview

Basic Information
Taxon OID3300023290 Open in IMG/M
Scaffold IDGa0256628_107627 Open in IMG/M
Source Dataset NameHuman gut microbial communities from healthy child feces in Northridge, California, USA -- CDI_10B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Irvine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3456
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location NameUSA: Northridge, California
CoordinatesLat. (o)34.2381Long. (o)-118.5301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070093Metagenome123N

Sequences

Protein IDFamilyRBSSequence
Ga0256628_1076271F070093N/ALLLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNYADSIS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.