Scaffold Ga0255842_1296151

Overview

Basic Information

• Taxon OID: 3300023211
• Scaffold ID: Ga0255842_1296151
• Source Dataset Name: Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Argonne National Laboratory
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1421
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source)

Source Dataset Sampling Location

• Location Name: Fort Collins, Colorado, USA
• Coordinates
  • Lat. (^o): 40.585258
  • Long. (^o): -105.084419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103340	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255842_12961511	F103340	N/A	GTPGGVSLTAGGGTAVMPTRDADGHAQLTSVVIETGEMQQLANPEISEPAGLRTARKAAVFAVVDSEGGAIYRAE