NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214478_112954

Scaffold Ga0214478_112954


Overview

Basic Information
Taxon OID3300022735 Open in IMG/M
Scaffold IDGa0214478_112954 Open in IMG/M
Source Dataset NameMarine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellD7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)862
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Seawater → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.746Long. (o)-122.0257Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100378Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0214478_1129541F100378N/ASDAYAIVGIPKSLPIHGMALTSTGRKIEHNKVVVDTQTYESNDSVSLEKLEFSPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.