| Basic Information | |
|---|---|
| Taxon OID | 3300022652 Open in IMG/M |
| Scaffold ID | Ga0232059_1213360 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_3 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 626 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 37.8719 | Long. (o) | -122.2585 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091427 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0232059_12133602 | F091427 | GGA | MLILGVYYAGISTTISLINLLATRRTLSIPGLRNRRILMPFISITILLMLRALAVITPVLGSAMLMLALDR |
| ⦗Top⦘ |