Scaffold Ga0197853_1015008

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0197853_1015008

Scaffold Ga0197853_1015008

Overview

Basic Information
Taxon OID	3300019775 Open in IMG/M
Scaffold ID	Ga0197853_1015008 Open in IMG/M
Source Dataset Name	Lab enriched sediment microbial communities from hydrocarbon-contaminated retail site, Toronto, Canada - S1, HI.1247_001
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Genome Quebec
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	602
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enriched Sediment → Metagenomes From Benzene-Degrading Nitrate-Reducing Cultures

Source Dataset Sampling Location
Location Name	Toronto, ON, Canada
Coordinates	Lat. (^o)	43.6532	Long. (^o)	-79.3832	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066909	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0197853_10150081	F066909	AGG	MTHVVSLRMPPEKVAAIDRRATDSGLDRTKYLLRLVDQDLARPARPSKRRFASLHLLGRFRSRGSSNAQVRAALKAQGEEDR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.