| Basic Information | |
|---|---|
| Taxon OID | 3300019775 Open in IMG/M |
| Scaffold ID | Ga0197853_1011526 Open in IMG/M |
| Source Dataset Name | Lab enriched sediment microbial communities from hydrocarbon-contaminated retail site, Toronto, Canada - S1, HI.1247_001 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Genome Quebec |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 104739 |
| Total Scaffold Genes | 111 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 71 (63.96%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enriched Sediment → Metagenomes From Benzene-Degrading Nitrate-Reducing Cultures |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toronto, ON, Canada | |||||||
| Coordinates | Lat. (o) | 43.6532 | Long. (o) | -79.3832 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025775 | Metagenome | 200 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0197853_101152688 | F025775 | GGAG | MKRLLTFQGFPMVVVTALIVWAWISIFSVLIASFF |
| ⦗Top⦘ |