NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187892_10013838

Scaffold Ga0187892_10013838


Overview

Basic Information
Taxon OID3300019458 Open in IMG/M
Scaffold IDGa0187892_10013838 Open in IMG/M
Source Dataset NameBio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9191
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (68.75%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Associated Families5

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameUSA: the Island of Hawaii
CoordinatesLat. (o)19.0643Long. (o)-155.8008Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020982Metagenome / Metatranscriptome221N
F041239Metagenome / Metatranscriptome160N
F077005Metagenome / Metatranscriptome117Y
F089941Metagenome / Metatranscriptome108Y
F093175Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0187892_1001383811F093175GGAGGMDGLKQIQVITQGDGWHLVGLDADGRCWFGSPRRSTKGRMLAWVLMDESVESEEPPPTMTPEPLQEAAGRPWPTKPRP
Ga0187892_1001383813F077005GGAGGMLPELPKEEQRRVCHGCGQAKFLPYSIRSGDPKTAVVRVYCSVACAQLHSPGFTGKDGRQ
Ga0187892_100138382F041239GGAMAERGLGLRALWEDRDYKACGASMECRGRFILGKLFDRDTRMLKVAWLAAFGTRVLGPPEIRTAEITKSQWQVILSHMGASPDEIADVQVRMSRT
Ga0187892_100138383F020982AGGAMARRHFMGSRIYKGLTYTLELEAVEESVFKAHARLSPSGPEVSVVDEASDAALKQAEAGIKHVIEQREAGTVVRERLPERMYGDVKYTIIVRTEATRVVAELYFIRSNAQPRRPGPGTFFALFEGKTKQGAIGQAERGLKAKLDKERASHRGGTLR
Ga0187892_100138388F089941N/AMITYTTEDFVRRAIGRLLHDKYRGGVVCSGCLIGMTLERLHAGWRKSEIERAMEKVFGTPGRLESMADGPCARCKRPAPCLGEPRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.