| Basic Information | |
|---|---|
| Taxon OID | 3300018624 Open in IMG/M |
| Scaffold ID | Ga0193577_112552 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Woods Hole Oceanographic Institution |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 501 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eastern Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 36.29 | Long. (o) | 15.39 | Alt. (m) | Depth (m) | 2200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061214 | Metagenome / Metatranscriptome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193577_1125521 | F061214 | N/A | VISARCRLVNGFANLTKIGLALKETPINGGLNDEGQTQSY |
| ⦗Top⦘ |