| Basic Information | |
|---|---|
| Taxon OID | 3300017819 Open in IMG/M |
| Scaffold ID | Ga0187713_103312 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ATCC 1651 MA medium w/o phosphatidylcholine, 4 C, 30 psu salinity and 140 ?mol photons light - Anophryoides haemophila AH6 (MMETSP1019) (SRX566756-SRR1328076) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 568 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 43.51667 | Long. (o) | -65.6 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187713_1033121 | F077438 | N/A | SEDFSVTSLGCVYATHRVQPSFRQSRFETLFLWNLQVEISSALRPKAEKEISSYKN |
| ⦗Top⦘ |