3300017819: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ATCC 1651 MA medium w/o phosphatidylcholine, 4 C, 30 psu salinity and 140 ?mol photons light - Anophryoides haemophila AH6 (MMETSP1019) (SRX566756-SRR1328076)

Overview

Basic Information

• IMG/M Taxon OID: 3300017819
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212296 | Ga0187713
• Sample Name: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in ATCC 1651 MA medium w/o phosphatidylcholine, 4 C, 30 psu salinity and 140 ?mol photons light - Anophryoides haemophila AH6 (MMETSP1019) (SRX566756-SRR1328076)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 7843519
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 43.51667
  • Long. (^o): -65.6
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0187713_103312	All Organisms → cellular organisms → Bacteria	568

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0187713_103312	Ga0187713_1033121	F077438	SEDFSVTSLGCVYATHRVQPSFRQSRFETLFLWNLQVEISSALRPKAEKEISSYKN