NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180217_1022413

Scaffold Ga0180217_1022413


Overview

Basic Information
Taxon OID3300017540 Open in IMG/M
Scaffold IDGa0180217_1022413 Open in IMG/M
Source Dataset NameEnriched Organic Plus compost microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C BE-Lig OP (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3271
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location NameUSA: Emeryville, California
CoordinatesLat. (o)37.83Long. (o)-122.29Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085354Metagenome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0180217_10224133F085354GGAGMAKKLAATSPAPSQPKPEERFVELMLVAADFVQSCGGLEPAKKALADAGKFVESAGSVESATRALEVLESLKQKIGT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.