Scaffold Ga0186390_108978

Overview

Basic Information

• Taxon OID: 3300017315
• Scaffold ID: Ga0186390_108978
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in K/2 medium, 17 C, 35 psu salinity and 672 ?mol photons light - Scyphosphaera apsteinii RCC 1455 (MMETSP1333)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1315
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Mediterranean Sea
• Coordinates
  • Lat. (^o): 41.39
  • Long. (^o): 2.48
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049399	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186390_1089781	F049399	GGA	VLSFSEIPAEFAEFVKAKQQELAFNMLSSSAAGVVLANLAALVAGDASVELLIQTSQAQIPLLILTLIASVLSGKVENKPW