Scaffold Ga0186684_102518

Overview

Basic Information

• Taxon OID: 3300017280
• Scaffold ID: Ga0186684_102518
• Source Dataset Name: Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3172
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Ligurian Sea
• Coordinates
  • Lat. (^o): 43.3
  • Long. (^o): 10.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060335	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186684_1025186	F060335	AGG	MDKKHGFYYLRIGTDTEQYDLSLKVKMFLKGDQVQSSEPNEKVYVYKYPEDKGGDVKLTTYCQIRPEQGKKTCDFIVPTTHHDKTFVYLQKKLETVPGKNGITLEAKPAADQEDGALLQ