NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060335

Metagenome / Metatranscriptome Family F060335

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060335
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 101 residues
Representative Sequence MKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQ
Number of Associated Samples 97
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 67.94 %
% of genes near scaffold ends (potentially truncated) 43.61 %
% of genes from short scaffolds (< 2000 bps) 81.95 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.241 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.556 % of family members)
Environment Ontology (ENVO) Unclassified
(57.895 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(63.910 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.88%    β-sheet: 35.77%    Coil/Unstructured: 59.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF00648Peptidase_C2 15.04



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.50 %
UnclassifiedrootN/A1.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10146216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300004687|Ga0065174_1061889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300004789|Ga0007752_10895950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300004790|Ga0007758_11255523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani981Open in IMG/M
3300004804|Ga0007796_10192304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300005941|Ga0070743_10155958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300006165|Ga0075443_10046493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1456Open in IMG/M
3300006165|Ga0075443_10109449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani957Open in IMG/M
3300006165|Ga0075443_10393424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300006415|Ga0099654_10135298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani729Open in IMG/M
3300006803|Ga0075467_10046853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2706Open in IMG/M
3300006803|Ga0075467_10106773All Organisms → Viruses → Predicted Viral1660Open in IMG/M
3300007231|Ga0075469_10216628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani509Open in IMG/M
3300007513|Ga0105019_1025540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3947Open in IMG/M
3300007513|Ga0105019_1029964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3549Open in IMG/M
3300007513|Ga0105019_1045000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2697Open in IMG/M
3300007667|Ga0102910_1023558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1389Open in IMG/M
3300007722|Ga0105051_10768059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300008119|Ga0114354_1069030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1466Open in IMG/M
3300008930|Ga0103733_1037904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300009154|Ga0114963_10240820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1030Open in IMG/M
3300009172|Ga0114995_10032577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3046Open in IMG/M
3300009172|Ga0114995_10074138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1919Open in IMG/M
3300009263|Ga0103872_1004044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1159Open in IMG/M
3300009432|Ga0115005_10057196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2986Open in IMG/M
3300009432|Ga0115005_10851336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300009436|Ga0115008_10120693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1929Open in IMG/M
3300009441|Ga0115007_10031393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3285Open in IMG/M
3300009442|Ga0115563_1101383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1229Open in IMG/M
3300009445|Ga0115553_1403155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300009470|Ga0126447_1042381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1128Open in IMG/M
3300009497|Ga0115569_10475291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani531Open in IMG/M
3300009592|Ga0115101_1346493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1497Open in IMG/M
3300009608|Ga0115100_10127487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1158Open in IMG/M
3300009677|Ga0115104_10361622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300010987|Ga0138324_10242378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300012413|Ga0138258_1133901All Organisms → Viruses → Predicted Viral1053Open in IMG/M
3300012504|Ga0129347_1181947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300012504|Ga0129347_1257819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300013295|Ga0170791_10699852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2758Open in IMG/M
3300013295|Ga0170791_13710843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani991Open in IMG/M
3300017280|Ga0186684_102518All Organisms → Viruses → Predicted Viral3172Open in IMG/M
3300017280|Ga0186684_103119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2847Open in IMG/M
3300017697|Ga0180120_10343340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300018730|Ga0192967_1084799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300018846|Ga0193253_1001254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3004Open in IMG/M
3300018846|Ga0193253_1001522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2879Open in IMG/M
3300018846|Ga0193253_1024862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1406Open in IMG/M
3300018871|Ga0192978_1008747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1657Open in IMG/M
3300018926|Ga0192989_10150123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300018989|Ga0193030_10231193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300019033|Ga0193037_10356093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300019033|Ga0193037_10368766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300019043|Ga0192998_10117343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300019048|Ga0192981_10015115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2210Open in IMG/M
3300019050|Ga0192966_10317670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300019051|Ga0192826_10382084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300019095|Ga0188866_1027239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300019095|Ga0188866_1028665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300019095|Ga0188866_1033835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300019131|Ga0193249_1129252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300019149|Ga0188870_10080458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300021169|Ga0206687_1105611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300021336|Ga0210307_1284002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300021365|Ga0206123_10340952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani629Open in IMG/M
3300021869|Ga0063107_111275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani873Open in IMG/M
3300021872|Ga0063132_125160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300021902|Ga0063086_1015444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1520Open in IMG/M
3300021925|Ga0063096_1062434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300021954|Ga0063755_1092244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300024343|Ga0244777_10483860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani762Open in IMG/M
3300024346|Ga0244775_10442554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1066Open in IMG/M
3300025887|Ga0208544_10055298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1903Open in IMG/M
3300025890|Ga0209631_10069869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2149Open in IMG/M
3300025890|Ga0209631_10544017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300026448|Ga0247594_1001781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2730Open in IMG/M
3300026448|Ga0247594_1043732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300026448|Ga0247594_1046714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300026448|Ga0247594_1083237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300026468|Ga0247603_1058615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani780Open in IMG/M
3300026470|Ga0247599_1009881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1929Open in IMG/M
3300026495|Ga0247571_1018415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1446Open in IMG/M
3300026495|Ga0247571_1023269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1313Open in IMG/M
3300026495|Ga0247571_1044288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani995Open in IMG/M
3300027752|Ga0209192_10147759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani930Open in IMG/M
3300027833|Ga0209092_10433443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300027849|Ga0209712_10317260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani882Open in IMG/M
3300028137|Ga0256412_1026621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1878Open in IMG/M
3300028137|Ga0256412_1047031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1488Open in IMG/M
3300028137|Ga0256412_1062267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1317Open in IMG/M
3300028137|Ga0256412_1211140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300028137|Ga0256412_1379443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300028282|Ga0256413_1015476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2293Open in IMG/M
3300028290|Ga0247572_1110055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300028290|Ga0247572_1194732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani510Open in IMG/M
3300030670|Ga0307401_10474980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300030671|Ga0307403_10010097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2836Open in IMG/M
3300030671|Ga0307403_10079292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1530Open in IMG/M
3300030671|Ga0307403_10133329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1248Open in IMG/M
3300030702|Ga0307399_10264793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani811Open in IMG/M
3300030702|Ga0307399_10388877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300030709|Ga0307400_10020369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2833Open in IMG/M
3300030709|Ga0307400_10094945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1712Open in IMG/M
3300031032|Ga0073980_11367371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300031062|Ga0073989_11358319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300031569|Ga0307489_11310478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300031710|Ga0307386_10183188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani999Open in IMG/M
3300031710|Ga0307386_10263485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300031729|Ga0307391_10287087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani891Open in IMG/M
3300031739|Ga0307383_10075338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1432Open in IMG/M
3300031752|Ga0307404_10325182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300032462|Ga0335396_10582284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300032463|Ga0314684_10004247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3243Open in IMG/M
3300032517|Ga0314688_10184731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1053Open in IMG/M
3300032517|Ga0314688_10677249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300032520|Ga0314667_10004061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3142Open in IMG/M
3300032522|Ga0314677_10002495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3228Open in IMG/M
3300032522|Ga0314677_10214910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani986Open in IMG/M
3300032616|Ga0314671_10097022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1434Open in IMG/M
3300032616|Ga0314671_10597587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300032617|Ga0314683_10015093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2898Open in IMG/M
3300032617|Ga0314683_10748862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300032650|Ga0314673_10362598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300032666|Ga0314678_10074174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1255Open in IMG/M
3300032707|Ga0314687_10026966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1952Open in IMG/M
3300032711|Ga0314681_10127314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1263Open in IMG/M
3300032713|Ga0314690_10064606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1499Open in IMG/M
3300032730|Ga0314699_10021672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1902Open in IMG/M
3300032733|Ga0314714_10085605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1541Open in IMG/M
3300032733|Ga0314714_10586031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300032748|Ga0314713_10125760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1033Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine15.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater15.04%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake4.51%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.51%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.26%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.50%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.50%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.50%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.75%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.75%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.75%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.75%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.75%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.75%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.75%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.75%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1014621623300001354Pelagic MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTTYHDRTYVYIQNKVAASLS*
Ga0065174_106188913300004687FreshwaterMHKREFYYIKDAIDKKHGFYFLRIGSNSDQYDLILKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIRPLKGKKTCEFLVPTNYHDRTYVYIQKKV
Ga0007752_1089595013300004789Freshwater LakeLNKAIKLASDPRFDKYFEIHKREFYYIKDAIDKKHGFYFLRIGSNSDKYDLILKIKVFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIRPLKGKKTCEFLVPTNYHDRTYVYIQKKVPAS
Ga0007758_1125552313300004790Freshwater LakeLNKAIKLASDPRFDKYFEIHKREFYYIKDAIDKKHGFYFLRIGSNSDKYDLILKIKVFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIRPLKGKKTCEFLVPTNYHDRTYVYIQKKVPASLR
Ga0007796_1019230423300004804FreshwaterMHKREFYYIKDAIDKKHGFYFLRIGSNSDQYDLILKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIR
Ga0070743_1015595813300005941EstuarineMKDAIDKKHGFYFLRVGSNSDEFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCEFLVPTSY
Ga0075443_1004649323300006165MarineMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKKEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHDRTYIYV*
Ga0075443_1010944913300006165MarineLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQN
Ga0075443_1039342413300006165MarineKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYV*
Ga0099654_1013529813300006415LakeLRIGSNSDKYDLILKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIRPLKGKKTCEFLVPTNYHDRTYVYIQKKVPASLR*IILL
Ga0075467_1004685313300006803AqueousMRLASDPRADPYFEIHKREFYYMKDAIDKKNGFYYLRVGSNSNEFDLTLKIKLFVKGDLIETTEKGEKLFVYKYPEDKFPGDFKLTTFCNIRPLQGKKTCDFLVPTEYHDRTYVYIQKKVPASKR*
Ga0075467_1010677353300006803AqueousMDKKHGYYYLRVGTDSDEFDLSLKVKMFLKGDQMETSEQDQKVYVYNYPQDKFPGGDYKLTTYCNIRPEHGKKRC
Ga0075469_1021662823300007231AqueousMDNKHGYYFLRVGSENDKYDLSLKVKMFLKGDQVESSEPDNKVYVYNYPDDKFSGGDYKLTT
Ga0105019_102554023300007513MarineMKDAMDKKHGFYFLRIGTDSDEYDLSLKVKMFLKGDQLETSEKNEKVYVYKYPQDKYPGGDFKLTTYCNIRPE*
Ga0105019_102996463300007513MarineMNEKLQKAVKLADNPKNDKFFEIHKRDFYYMKDAMDKKHGFYYLRIGTDSDEHDLSLKIKMFLQGDQLETTENKEKLYVYKFPEEKFPGGDFKLTTYCNIRPEQGKKHCDFLVPTKHHDRTYVYV*
Ga0105019_104500013300007513MarineMKDAIDKKHGFYFLRIGSNSDKFDLTLKIKMFVKGELVESTEKNEKLYVYKYPEDKFPGDYKLTTSCSIRPLRGKKTCDFLVPT*
Ga0102910_102355833300007667EstuarineMKAAIDKKHGFYFLRVGSNSDEFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCEFLVPTSYHDRTYVYIQNKVKASKR*
Ga0105051_1076805913300007722FreshwaterMRLASDPRADPFFETHKREFYYMKDAIDKKHGFYYLRVGSNSNKYDLTLKIKMFVKGDMVETTEKNEKLYVYKYPEDMFPGDFKLTTFCNIRPLKGKKTCDFLIPTEYHDRTYVYIQKKVAASKR*
Ga0114354_106903033300008119Freshwater, PlanktonMKLASDVRFDKYFEVHKREFYYMKDAIDKKHGFYFLRIGSNSDDYDLILKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYI*
Ga0103733_103790423300008930Ice Edge, Mcmurdo Sound, AntarcticaLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYV
Ga0114963_1024082013300009154Freshwater LakeLNKAIKLASDPRFDKYFEIHKREFYYIKDAIDKKHGFYFLRIGSNSDKYDLILKIKVFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIRPLKGKKTCEFLVPTNYHDRTYVYIQKKVPASLR*
Ga0114995_1003257793300009172MarineLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASKR*
Ga0114995_1007413843300009172MarineMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHDRTYIYV*
Ga0103872_100404413300009263Surface Ocean WaterMKDAIDKKHGYYFLRVGSNSDEFDLTLKIKMFVKGELVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCEFLVPTSYHDRTYVYIQNKVKASKR*
Ga0115005_1005719653300009432MarineLASDPRADKFFETHRREFYYMKDAIDKKHGFYFLRVGSNNDDFDLTLKLKIFVKGNIVETTEKNEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYIQKKLPASKR*
Ga0115005_1085133623300009432MarineMKDAIDKKHGFYFLRVGSNSDDTDLNLKIKMFLQGDQLETTEKDEKVYIYKYPKDKFPGGDYKLTTYCNIRPGQGKKSCDFLVPTTHHDRT*
Ga0115008_1012069313300009436MarineMKDAIDKKHGFYFLRVGSNSDQFDLTLKIKMFVKGDLVETTEKNEKLFVYKYPEDKFPGDYKLTTSCSIRPLRGKKTCDFLVPT*
Ga0115007_1003139323300009441MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGELVESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCDFLIPT*
Ga0115563_110138313300009442Pelagic MarineMKDAMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYV*
Ga0115553_140315523300009445Pelagic MarineYMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTTYHDRTYVYIQNKVAASLS*
Ga0126447_104238113300009470Meromictic PondMKDAIDKKHGFYFLRVGSNSDDFDLTLKIKMFVKGDLVETTEKGEKLYIYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQKKVPASKR*
Ga0115569_1047529113300009497Pelagic MarineREFYYMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTTYHDRTYVYIQNKVAASLS*
Ga0115101_134649313300009592MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTNYHDRTYVYIQNKVAASLS*
Ga0115100_1012748713300009608MarineLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASK
Ga0115104_1036162213300009677MarineMKDAMDKKHGFYFLRVGSDSDTADLSLKVKMFLKGDHVETTEDKEKVYVYKYPQDKFPGGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYV*
Ga0138324_1024237823300010987MarineMKDAMDKKHGFYFLRIGTDSDQYDLSLKVKMFLKGDQLETSEKNEKLYVYKYPQDKYPGGDFKLTTYCNIRPE*
Ga0138258_113390113300012413Polar MarineMKDAIDKKHGFYFLRVGSNNDDFDLTLKIKMFVKGNIVETTEKSEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYIQKKLPASKR*
Ga0129347_118194723300012504AqueousMKDAIDKKHGFYFLRIGSNSDEHDLSLKIKMFVNGDLVETTEKSEKLYVYKYPEDKFPGSYKLTTFCQIRPLKGKKTCDFLVPTSYHDR
Ga0129347_125781913300012504AqueousLADDPKNDKFFEIHRKENYYMKDAMDKKHGFYFLRVGSDSETADLSLKVKMFLKGDHVETTEDKEKVYVYKYPADKFPGGDYKLTTYCNIRPEQGKKTCDFLVPTTHHDRTYVYVQKKIDIPQ*
Ga0170791_1069985213300013295FreshwaterLNKAIKLASDPRFDKYFEIHKREFYYIKDAIDKKHGFYFLRIGSNSDKYDLILKIKVFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTYCNIRPLKGKKTCEFLVPTNYHDRTYVY
Ga0170791_1371084313300013295FreshwaterMKLASDSRFDKYFEVHKREFYYMKDAIDKKHGFYFLRIGSNSDDYDLILKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYI*
Ga0186684_10251863300017280Host-AssociatedMDKKHGFYYLRIGTDTEQYDLSLKVKMFLKGDQVQSSEPNEKVYVYKYPEDKGGDVKLTTYCQIRPEQGKKTCDFIVPTTHHDKTFVYLQKKLETVPGKNGITLEAKPAADQEDGALLQ
Ga0186684_10311913300017280Host-AssociatedMKATKLASDPKADSYFEIHKREYYYMKDAVDKKHGFYYLRIGSNSDKYDLSLKIKMFVKGDLVETTEKAEKLYVFKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTDYHDRTYVYI
Ga0180120_1034334013300017697Freshwater To Marine Saline GradientMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLNNFCKIMPLKGKKTCDF
Ga0192967_108479913300018730MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTYCKIMPLKGKKTCDFLVPTNYHDRTYVYIQNKVAASLS
Ga0193253_100125493300018846MarineMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHDRTYIYV
Ga0193253_100152273300018846MarineLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASKR
Ga0193253_102486213300018846MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTNYHDRTYVYIQNKVAASLS
Ga0192978_100874713300018871MarineMKDAIDKKHGFYFLRVGSNSDKFDLTLKIKMFVKGDLVESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCDFLVPT
Ga0192977_112160213300018874MarineLTEIIKGPLAGKLSKAIKLAGDPAASSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTTCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNKEPA
Ga0192989_1015012313300018926MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTNYHDRTYVYIQNKVAASL
Ga0193030_1023119313300018989MarineLNKAIKLASDPRADSFFEIHKREFYYMKDAIDKKHGFYFLRVGSNSDKFDLTLKIKMFVKGELVESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCDFLVPTQYHDRTYVYIQNKVPASRR
Ga0193037_1035609313300019033MarineMKDAIDKKHGFYFLRVGSNSDKYDLSLKIKMFVKGDLVETTEKGEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTQYHDRTYVYIQKKMPASKR
Ga0193037_1036876613300019033MarineVLAQKLQKAVSLADDHKNDKFFELHQRDFYYMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGNHLETTEKKEKLYVYKYPQEGGDYKLTTYCNIRPEQGKKTCDFLVPTGHHDRTYVYVQKKLPVG
Ga0192998_1011734313300019043MarineMKDAIDKRHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDFKLTTFCNIRPLK
Ga0192981_1001511513300019048MarineMKDAIDKKHGFYFLRVGSNSEKFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPT
Ga0192966_1031767013300019050MarineLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASKR
Ga0192826_1038208423300019051MarineMKDAIDKKHGFYFLRVGSNSDQFDLTLKIKMFVKGDLVESTERNEKLFVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCDFLVPT
Ga0188866_102723913300019095Freshwater LakeMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDFLVPTTYHDRTYVYIQNKVAASLS
Ga0188866_102866513300019095Freshwater LakeLDKLTKAIRLAGDTRAEKFFEMHKREVYYMKDAIDKKHGFYFLRVGSNSDAFDLSLKIKMFVKGDLLESSEKSEKLYVYKYPEDKFPGDYKLTTYCNIRPLQGKRTCDFLVPTNYHDRTYVYI
Ga0188866_103383513300019095Freshwater LakeFEQHKREFYYMKDAIDKRHGFYFLRVGSNSDDYDLSLKIKMFVKGDLVESSEKGEKLYVYKYPEDKFPGDYKLTTFCNIRPLQGKRTCDFIVPTSYHDRTYVYIQKKAPASLR
Ga0193249_112925223300019131MarineMKDAIDKKHGFYFLRVGANSDAFDLSLKIKIFVKGELLETTERAEKLFVYKYPEDKFPGDFKLTTFCNIRP
Ga0188870_1008045813300019149Freshwater LakeMKDAIDKKHGFYYLRVGSNSDDYDLSLKIKMFVKGDLVESSEKGEKLYVYKYPEDKFPGDYKLTTFCNIRPLQGKRTCDFIVPTSYHDRTYVYI
Ga0206687_110561113300021169SeawaterLASDPRADKFFETHRREFYYMKDAIDKKHGFYFLRVGSNNDDFDLTLKLKIFVKGNIVETTEKNEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYIQKKLPASKRXLKSKS
Ga0210307_128400223300021336EstuarineMKDAIDKKHGFYFLRVGSNSDEFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCEFLVPTSYHDR
Ga0206123_1034095213300021365SeawaterMKDAIDKKHGFYFLRVGSNSEKFDLQLKIKMFVKGDLVETTEKAEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDF
Ga0063107_11127533300021869MarineMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGELVESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCDFLIPT
Ga0063132_12516013300021872MarineMKDAMDKKHGFYYLRIGTDSNEQDLSLKIKMFLQGDQLETTENKEKLYTYQFPEDKFPDGDFKLTTYCNIRPE
Ga0063086_101544433300021902MarineMKDAIDKKHGFYFLRVGSNSDQFDLTLKIKMFVKGDLVETTEKNEKLFVYKYPEDKFPGDYKLTTSCSIRPLRGKKTCDFLVPT
Ga0063096_106243413300021925MarineMKDAIDKKHGFYFLRVGSNSDKFDLTLKIKMFVKGELVESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCEFLVPT
Ga0063755_109224423300021954MarineMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVP
Ga0244777_1048386023300024343EstuarineMKDAIDKKHGFYFLRVGSNSDEFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCEFLVPTSYHDRTYVYIQNKVKASKRXLFKNLSFNTGFWGFG
Ga0244775_1044255423300024346EstuarineMKDAIDKKHGFYFLRVGSNSDEFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCEFLVPTSYHDRTYVYIQNKVKASKRXLFKNLSFNRGFGVLG
Ga0208544_1005529813300025887AqueousMRLASDPRADPYFEIHKREFYYMKDAIDKKNGFYYLRVGSNSNEFDLTLKIKLFVKGDLIETTEKGEKLFVYKYPEDKFPGDFKLTTFCNIRPLQGKKTCDFLVPTEYHDRTYVYIQKKVPASKR
Ga0209631_1006986913300025890Pelagic MarineMKDAMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYV
Ga0209631_1054401723300025890Pelagic MarineMKDAIDKKHGFYFLRVGSNSEKFDLQLKIKMFVKGDLVETTEKAEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKK
Ga0247594_100178113300026448SeawaterMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTYCKIMPLKGKKTCDFLVPTNYHD
Ga0247594_104373223300026448SeawaterMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPADKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHD
Ga0247594_104671413300026448SeawaterLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKVKKTCDFLVPTNYHDRTYVYIQNKVPASKR
Ga0247594_108323723300026448SeawaterMKDAIDKKHGFYFLRVGSNSDDTNLDLKIKMFLQGDQLETTEKDEKVYIYKYPKDKFPGGDYKLTTFCNIRPGQGKKSCDFLVPTTHHDRT
Ga0247603_105861513300026468SeawaterMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTFCKIMPLKGKKTCDF
Ga0247599_100988153300026470SeawaterMKDAIDKKHGFYFLRVGSNSDQYDLTLKIKMFVKGDLVETTEKNEKLYVYKYPEDKFPGAYKLTTYCKIMPLKGKKTCDFLVPTNYHDRTYVYIQNKVA
Ga0247571_101841523300026495SeawaterMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPADKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHDRTYIYV
Ga0247571_102326923300026495SeawaterMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASKRXNFIMSYSIGVIQII
Ga0247571_104428813300026495SeawaterMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYV
Ga0209192_1014775923300027752MarineMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASKR
Ga0209092_1043344313300027833MarineMYYMKDAMDKKHGFYYLRIGSDSNDHDLSLKVKMFLKGDQLETTEDKEKLYVYKFPEDKPEGSDFKLTTYCNIRPE
Ga0209712_1031726013300027849MarineLASDPRADKFFETHRREFYYMKDAIDKKHGFYFLRVGSNNDDFDLTLKLKIFVKGNIVETTEKNEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYIQKKLPASKRXXKSKSKFIYYLSYYKS
Ga0256412_102662143300028137SeawaterMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNKEPASKRXKNFFSNVI
Ga0256412_104703113300028137SeawaterMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPE
Ga0256412_106226733300028137SeawaterMKDAIDKKHGFYFLRVGSNNDDFDLTLKLKIFVKGNIVETTEKNEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYIQKKLPASKR
Ga0256412_121114013300028137SeawaterMKDAIDKKHGFYFLRVGSNNDDFDLTLKIKMFVKGNIVETTEKSEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYI
Ga0256412_137944313300028137SeawaterMKDAMDKKHGFYFLRVGSDSDNADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYVQKKIDI
Ga0256413_101547663300028282SeawaterMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQ
Ga0247572_111005523300028290SeawaterMRDAMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPE
Ga0247572_119473223300028290SeawaterMKDAIDKKHGFYFLRVGSNDDKYDLTLKIKMFVKGDLVETTEKSEKLFVYKYPEDKFPGDFKLTTFCNIR
Ga0307401_1047498033300030670MarineMKDAIDKKHGFYFLRVGSNSDKFDLTLKIKMFVKGDLVESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRP
Ga0307403_1001009723300030671MarineMDKKHGFYYLRIGTDQDKYDLSLKVKIFVKGDHIETTEKNEKIYTYKYPQDGGDYKLTTYCNIRPE
Ga0307403_1007929253300030671MarineMKDAIDKRHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNKVPASKR
Ga0307403_1013332913300030671MarineMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKKEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHDRTYIYV
Ga0307399_1026479323300030702MarineMKDAIDKKHGFYFLRVGSNSEKFDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIR
Ga0307399_1038887713300030702MarineMKDAIDKKHGFYFLRVGSNSDQFDLTLKIKMFVKGDIVETTEKSEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCEFLIPTQYHDRTYVYI
Ga0307400_1002036913300030709MarineLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYIQNKVPASK
Ga0307400_1009494513300030709MarineMKDAIDKKHGFYFLRIGSNSDEHDLVLKIKMFVNGDLVETTEKSEKLYVYKYPEDKFPGSYKLTTFCQIRPLKGKKTCDFLV
Ga0073980_1136737113300031032MarineMKDAMDKKHGFYFLRVGADSDTADLSLKVKMFLKGDHVETTEDNEKVYVYKYPIDKYPGGDYKLTTYCNIRPEQGKKTCDFLV
Ga0073989_1135831913300031062MarineLANDPKSDKFFEVHKREFYYMKDAIDKKHGFYFLRVGSNSNQYDLQLKIKLFVKSDLVESTEKSEKLYVYKFPEDKYPGDYKLQTYCNIRPLKGKKTCDFIVPTTYHARTYVYLKQKTPASRR
Ga0307489_1131047813300031569Sackhole BrineMKDALDKKHGFYFLRVGTNDDKFDLSLKVKMFLKGDHVETTENDEKLYVYKYPEDKFPNGDFKLTTYCNIRPEEGKKTCDFLVPTAQHDRTYVYV
Ga0307386_1018318813300031710MarineLASDPRADKFFETHRREFYYMKDAIDKKHGFYFLRVGSNNDDFDLTLKLKIFVKGNIVETTEKNEKLYVYQYPEDKFPDDYKLTTFCNIRPLKGKKFCDFLVPTVYHDRTYVYIQKKLPA
Ga0307386_1026348523300031710MarineMQTKLKKAMSLADNPKNDKFFEIHKRDFYYMKDAMDKKHGFYFLRIGTDSNDHDLSLKVKMFLKGDQLETTEDKEKLYVYKYPTDKFPGGDFKLTTYCNIRPEQTKKHCDFLVPTEHHDRTYVYVQKKINVSKENSALTPSTQA
Ga0307391_1028708723300031729MarineMKDAIDKRHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVP
Ga0307383_1007533813300031739MarineMQTKLKKAMSLADNPKNDKFFEIHKRDFYYMKDAMDKKHGFYFLRIGTDSNDHDLSLKVKMFLKGDQLETTEDKEKLYVYKYPTDKFPGGDFKLTTYCNIRPEQTKKHCDFLVPTEHHDRTYVYVQKKINVSKENSALTPST
Ga0307404_1032518213300031752MarineMKDAIDKKHGFYFLRIGSNSDKFDLTLKIKMFVKGELIESTERNEKLYVYKYPEDKFPGDYKLTTFCSIRPLRGKKTCDFLVPT
Ga0335396_1058228423300032462FreshwaterLIGKLNKAMRLASDPRADPFFETHKREFYYMKDAIDKKHGFYYLRVGSNSNKYDLTLKIKMFVKGDMVETTEKNEKLYVYKYPEDMFPGDFKLTTFCNIRPLKGKKTCDFLIPTEYHDRTYVYIQKKVAASKR
Ga0314684_1000424793300032463SeawaterMKDAMDKKHGFYFLRVGSDSETADLSLKVKMFLKGDHVETTEDNEKVYVYKYPVDKFPGGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYVQKKIDIPQ
Ga0314688_1018473113300032517SeawaterMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYVQKKIDIAPGSTEE
Ga0314688_1067724913300032517SeawaterMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTA
Ga0314667_1000406173300032520SeawaterMKDAMDKKHGFYFLRVGSDSETADLSLKVKMFLKGDHVETTEDNEKVYVYKYPVDKFPGGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDR
Ga0314677_1000249583300032522SeawaterMKDAMDKKHGFYFLRVGSDSETADLSLKVKMFLKGDHVETTEDNEKVYVYKYPVDKFPGGDFKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYVQKKIDIPQ
Ga0314677_1021491033300032522SeawaterLTEIIKGPLAGKLSKAIKLAGDPAASSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDR
Ga0314682_1044115223300032540SeawaterLTEIIKGPLAGKLSKAIKLAGDPAASSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNKEP
Ga0314671_1009702233300032616SeawaterMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFL
Ga0314671_1059758713300032616SeawaterEIIKGPLAGKLSKAIRLASDPTADQFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDEHDLTLKIKMFVNGDLVETTEKTEKLYVYKYPEDKFPGSYKLTTFCQIRPLKGKKTCDFLVPASYHDRTYVYI
Ga0314683_1001509313300032617SeawaterMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNKEPASK
Ga0314683_1074886213300032617SeawaterMDKKHGFYFLRVGSESENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYV
Ga0314673_1036259813300032650SeawaterMKDAMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPEDKFPGGDYKLTTYCNIR
Ga0314678_1007417423300032666SeawaterMDKKHGFYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSH
Ga0314687_1002696663300032707SeawaterLASDPRADSFFETHKREFYYMKDAIDKKHGFYFLRVGSNSDQFDLSLKIKMFVKGDLLETTEKNEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTNYHDRTYVYI
Ga0314681_1012731413300032711SeawaterMDKKHGVYFLRVGSDSENADLSLKVKMFLKGDHVETTEDKEKVYVYKYPVDKFPDGDYKLTTYCNIRPEQGKKTCDFLVPTSHHDRTYVYVQKKIDIAPGSTEE
Ga0314690_1006460613300032713SeawaterMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSY
Ga0314699_1002167213300032730SeawaterLTEIIKGPLAGKLSKAIKLAGDPAASSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTY
Ga0314714_1008560513300032733SeawaterMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTEKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNKEPA
Ga0314714_1058603113300032733SeawaterMKDSMDKKHGFYYLRVGTDSDQYDLSLKVKMFLKGDHLETTEKNEKLYVYKYPEDKFPGGDYKLTTYCNIRPDQGKKTCDFLVPTAHHDRTYIYV
Ga0314713_1012576033300032748SeawaterLTEIIKGPLAGKLSKAIKLAGDPAASSFFETHKREFYYMKDAIDKKHGFYFLRIGSNSDEYDLTLKIKMFVKGDLVETTVKSEKLYVYKYPEDKFPGDYKLTTFCNIRPLKGKKTCDFLVPTSYHDRTYVYIQNK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.