Scaffold Ga0186209_113040

Overview

Basic Information

• Taxon OID: 3300017146
• Scaffold ID: Ga0186209_113040
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 752 ?mol photons light - Emiliania huxleyi CCMP 370 (MMETSP1157)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1045
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049399	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186209_1130401	F049399	GGAG	MSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAEMARPPWAK