Basic Information | |
---|---|
Taxon OID | 3300016985 Open in IMG/M |
Scaffold ID | Ga0186682_113732 Open in IMG/M |
Source Dataset Name | Metatranscriptome of coastal eukaryotic communities from Mediterranean Sea in K medium, 20 C, 36 psu salinity and 677 ?mol photons light - Leptocylindrus danicus B650 (MMETSP0321) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | National Center for Genome Resources |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 724 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea | |||||||
Coordinates | Lat. (o) | 40.8083 | Long. (o) | 14.25 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051162 | Metagenome / Metatranscriptome | 144 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186682_1137321 | F051162 | N/A | MAKPIPLSSLQASMCKIWGTTPETTKLILSRVEDWTTSGLQDEDCYVSIRAKGTEQRTREIVLDGMKQVSDAFSTHDLVANVRLETYEGARYFHVPPPMKT |
⦗Top⦘ |