| Basic Information | |
|---|---|
| Taxon OID | 3300016871 Open in IMG/M |
| Scaffold ID | Ga0186591_106358 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic communities from Arctic in K medium with Eastern Pacific seawater w/o silicate, 6 C, 35 psu salinity and 535 ?mol photons light - micromonas sp. CCMP2099 (MMETSP0802) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | National Center for Genome Resources |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1272 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic | |||||||
| Coordinates | Lat. (o) | 76.2833 | Long. (o) | -74.75 | Alt. (m) | Depth (m) | 55 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F083611 | Metagenome / Metatranscriptome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0186591_1063582 | F083611 | GGAG | MTKRRTTTRTQTIAMSGKNARARKKKSERRDANAANMANAGEAIPGLLNDIVVTHILRSEYFDDPADL |
| ⦗Top⦘ |