3300016871: Metatranscriptome of marine eukaryotic communities from Arctic in K medium with Eastern Pacific seawater w/o silicate, 6 C, 35 psu salinity and 535 ?mol photons light - micromonas sp. CCMP2099 (MMETSP0802)

Overview

Basic Information

• IMG/M Taxon OID: 3300016871
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212303 | Ga0186591
• Sample Name: Metatranscriptome of marine eukaryotic communities from Arctic in K medium with Eastern Pacific seawater w/o silicate, 6 C, 35 psu salinity and 535 ?mol photons light - micromonas sp. CCMP2099 (MMETSP0802)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 21211067
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Arctic
• Coordinates
  • Lat. (^o): 76.2833
  • Long. (^o): -74.75
  • Alt. (m): N/A
  • Depth (m): 55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083611	Metagenome / Metatranscriptome	112	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186591_104068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas	1969
Ga0186591_106358	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas	1272

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186591_104068	Ga0186591_1040682	F083611	MSGKKARARKEKRGRRRDANAGEAIPGLLNDIVVTHVLRSEHFDDPADLARLPAVSRA
Ga0186591_106358	Ga0186591_1063582	F083611	MTKRRTTTRTQTIAMSGKNARARKKKSERRDANAANMANAGEAIPGLLNDIVVTHILRSEYFDDPADL