Scaffold Ga0186591_104068

Overview

Basic Information

• Taxon OID: 3300016871
• Scaffold ID: Ga0186591_104068
• Source Dataset Name: Metatranscriptome of marine eukaryotic communities from Arctic in K medium with Eastern Pacific seawater w/o silicate, 6 C, 35 psu salinity and 535 ?mol photons light - micromonas sp. CCMP2099 (MMETSP0802)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: National Center for Genome Resources
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1969
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Source Dataset Sampling Location

• Location Name: Arctic
• Coordinates
  • Lat. (^o): 76.2833
  • Long. (^o): -74.75
  • Depth (m): 55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083611	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186591_1040682	F083611	N/A	MSGKKARARKEKRGRRRDANAGEAIPGLLNDIVVTHVLRSEHFDDPADLARLPAVSRA