Scaffold Ga0182827_10012256

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182827_10012256

Scaffold Ga0182827_10012256

Overview

Basic Information
Taxon OID	3300014967 Open in IMG/M
Scaffold ID	Ga0182827_10012256 Open in IMG/M
Source Dataset Name	Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Ka
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	816
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes

Source Dataset Sampling Location
Location Name	Kuujjuarapik
Coordinates	Lat. (^o)	55.275009	Long. (^o)	-77.758484	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053953	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182827_100122562	F053953	AGGCGG	MDEPTDAKECCRRTRERWERRIRAYYASFPVIKDVPCDGCREILEIRVFASPVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.