| Basic Information | |
|---|---|
| Family ID | F053953 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 140 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MAEPAEKDCCRRTRERWLARIRAYFTSFPVIKDVPCDECREILEIRVY |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 140 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.71 % |
| % of genes near scaffold ends (potentially truncated) | 47.14 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (13.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.37% β-sheet: 15.79% Coil/Unstructured: 61.84% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 140 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 6.43 |
| PF13560 | HTH_31 | 5.00 |
| PF05977 | MFS_3 | 4.29 |
| PF12345 | DUF3641 | 4.29 |
| PF03795 | YCII | 2.86 |
| PF07687 | M20_dimer | 2.14 |
| PF04055 | Radical_SAM | 1.43 |
| PF00535 | Glycos_transf_2 | 1.43 |
| PF12146 | Hydrolase_4 | 1.43 |
| PF13419 | HAD_2 | 0.71 |
| PF01906 | YbjQ_1 | 0.71 |
| PF13353 | Fer4_12 | 0.71 |
| PF04784 | DUF547 | 0.71 |
| PF09994 | DUF2235 | 0.71 |
| PF02518 | HATPase_c | 0.71 |
| PF01381 | HTH_3 | 0.71 |
| PF13414 | TPR_11 | 0.71 |
| PF00271 | Helicase_C | 0.71 |
| PF05199 | GMC_oxred_C | 0.71 |
| PF04069 | OpuAC | 0.71 |
| PF06725 | 3D | 0.71 |
| PF13847 | Methyltransf_31 | 0.71 |
| PF00497 | SBP_bac_3 | 0.71 |
| PF00989 | PAS | 0.71 |
| COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
|---|---|---|---|
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 4.29 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.86 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.71 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.71 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.86 % |
| Unclassified | root | N/A | 32.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105832789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300000559|F14TC_102022771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300004156|Ga0062589_100865713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300004281|Ga0066397_10038654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300004463|Ga0063356_102241624 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300004480|Ga0062592_100122249 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300004643|Ga0062591_100688304 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005174|Ga0066680_10549561 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005186|Ga0066676_10949277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300005332|Ga0066388_100352499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2118 | Open in IMG/M |
| 3300005332|Ga0066388_101132593 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005332|Ga0066388_101466381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1191 | Open in IMG/M |
| 3300005332|Ga0066388_101573918 | Not Available | 1155 | Open in IMG/M |
| 3300005332|Ga0066388_101693135 | Not Available | 1119 | Open in IMG/M |
| 3300005332|Ga0066388_102947171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300005332|Ga0066388_104166175 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005332|Ga0066388_105853397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300005439|Ga0070711_101869699 | Not Available | 527 | Open in IMG/M |
| 3300005441|Ga0070700_100504377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 931 | Open in IMG/M |
| 3300005444|Ga0070694_101872293 | Not Available | 512 | Open in IMG/M |
| 3300005445|Ga0070708_100042488 | All Organisms → cellular organisms → Bacteria | 3990 | Open in IMG/M |
| 3300005445|Ga0070708_101583326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300005451|Ga0066681_10095545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1694 | Open in IMG/M |
| 3300005456|Ga0070678_102066231 | Not Available | 539 | Open in IMG/M |
| 3300005467|Ga0070706_100305103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1485 | Open in IMG/M |
| 3300005467|Ga0070706_100579888 | Not Available | 1043 | Open in IMG/M |
| 3300005467|Ga0070706_101354213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 652 | Open in IMG/M |
| 3300005518|Ga0070699_100430053 | Not Available | 1196 | Open in IMG/M |
| 3300005529|Ga0070741_10006312 | All Organisms → cellular organisms → Bacteria | 25595 | Open in IMG/M |
| 3300005536|Ga0070697_100024994 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
| 3300005536|Ga0070697_100133918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2080 | Open in IMG/M |
| 3300005536|Ga0070697_100572620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 991 | Open in IMG/M |
| 3300005536|Ga0070697_100746149 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005546|Ga0070696_101373244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005556|Ga0066707_10097978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1796 | Open in IMG/M |
| 3300005556|Ga0066707_10675913 | Not Available | 650 | Open in IMG/M |
| 3300005559|Ga0066700_10801112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300005576|Ga0066708_10696802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300005614|Ga0068856_101192153 | Not Available | 778 | Open in IMG/M |
| 3300005713|Ga0066905_100311677 | Not Available | 1241 | Open in IMG/M |
| 3300005713|Ga0066905_101145400 | Not Available | 693 | Open in IMG/M |
| 3300005713|Ga0066905_101734858 | Not Available | 574 | Open in IMG/M |
| 3300005713|Ga0066905_101775080 | Not Available | 568 | Open in IMG/M |
| 3300005764|Ga0066903_100552343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1975 | Open in IMG/M |
| 3300005764|Ga0066903_100749012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1734 | Open in IMG/M |
| 3300005764|Ga0066903_100798540 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300005764|Ga0066903_101617638 | Not Available | 1229 | Open in IMG/M |
| 3300005764|Ga0066903_102638525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 974 | Open in IMG/M |
| 3300005764|Ga0066903_103618422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 832 | Open in IMG/M |
| 3300005937|Ga0081455_10672041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300005985|Ga0081539_10227660 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300006755|Ga0079222_12265441 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006797|Ga0066659_10513561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300006847|Ga0075431_101975883 | Not Available | 538 | Open in IMG/M |
| 3300006854|Ga0075425_100905813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300006854|Ga0075425_102507254 | Not Available | 571 | Open in IMG/M |
| 3300006871|Ga0075434_100825779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300006903|Ga0075426_11061641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300007076|Ga0075435_101172532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300009090|Ga0099827_10188116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1711 | Open in IMG/M |
| 3300009148|Ga0105243_10972391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 849 | Open in IMG/M |
| 3300009156|Ga0111538_12343864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300009792|Ga0126374_10149249 | Not Available | 1414 | Open in IMG/M |
| 3300010046|Ga0126384_10185381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1635 | Open in IMG/M |
| 3300010046|Ga0126384_11745509 | Not Available | 590 | Open in IMG/M |
| 3300010047|Ga0126382_10652748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 875 | Open in IMG/M |
| 3300010154|Ga0127503_10150647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300010320|Ga0134109_10328473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300010337|Ga0134062_10765315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300010359|Ga0126376_10252405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1501 | Open in IMG/M |
| 3300010360|Ga0126372_10362499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1305 | Open in IMG/M |
| 3300010362|Ga0126377_12133402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300010362|Ga0126377_13153318 | Not Available | 533 | Open in IMG/M |
| 3300010371|Ga0134125_12159981 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010391|Ga0136847_10497799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300010391|Ga0136847_12557713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300010397|Ga0134124_10553973 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300010400|Ga0134122_10221554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1581 | Open in IMG/M |
| 3300010403|Ga0134123_12739658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300012202|Ga0137363_11107704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300012582|Ga0137358_10296289 | Not Available | 1098 | Open in IMG/M |
| 3300012944|Ga0137410_11271050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300014967|Ga0182827_10012256 | Not Available | 816 | Open in IMG/M |
| 3300014967|Ga0182827_10038296 | Not Available | 543 | Open in IMG/M |
| 3300015358|Ga0134089_10354948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300015358|Ga0134089_10528735 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300016341|Ga0182035_11397027 | Not Available | 628 | Open in IMG/M |
| 3300016341|Ga0182035_11599116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300016422|Ga0182039_12257688 | Not Available | 502 | Open in IMG/M |
| 3300017959|Ga0187779_11230701 | Not Available | 528 | Open in IMG/M |
| 3300017974|Ga0187777_10968555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300018058|Ga0187766_10039836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2744 | Open in IMG/M |
| 3300018433|Ga0066667_11536725 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300019458|Ga0187892_10500921 | Not Available | 559 | Open in IMG/M |
| 3300022213|Ga0224500_10371057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300022214|Ga0224505_10139233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300025905|Ga0207685_10865670 | Not Available | 501 | Open in IMG/M |
| 3300025910|Ga0207684_10826284 | Not Available | 782 | Open in IMG/M |
| 3300025910|Ga0207684_11282487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300025923|Ga0207681_11333189 | Not Available | 603 | Open in IMG/M |
| 3300026075|Ga0207708_10534738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 986 | Open in IMG/M |
| 3300026078|Ga0207702_11102371 | Not Available | 788 | Open in IMG/M |
| 3300026116|Ga0207674_12067224 | Not Available | 534 | Open in IMG/M |
| 3300026317|Ga0209154_1157022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300026317|Ga0209154_1200956 | Not Available | 767 | Open in IMG/M |
| 3300026327|Ga0209266_1172914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
| 3300026537|Ga0209157_1391205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300026540|Ga0209376_1034737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3100 | Open in IMG/M |
| 3300027900|Ga0209253_10096088 | Not Available | 2430 | Open in IMG/M |
| 3300030336|Ga0247826_11534041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300030606|Ga0299906_10002240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16125 | Open in IMG/M |
| 3300030620|Ga0302046_10015175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6465 | Open in IMG/M |
| 3300031544|Ga0318534_10244317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1036 | Open in IMG/M |
| 3300031564|Ga0318573_10192360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300031713|Ga0318496_10842286 | Not Available | 505 | Open in IMG/M |
| 3300031720|Ga0307469_10785928 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031723|Ga0318493_10235437 | Not Available | 975 | Open in IMG/M |
| 3300031740|Ga0307468_100251804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1243 | Open in IMG/M |
| 3300031765|Ga0318554_10115170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1516 | Open in IMG/M |
| 3300031782|Ga0318552_10205314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 997 | Open in IMG/M |
| 3300031820|Ga0307473_11082316 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031820|Ga0307473_11253603 | Not Available | 553 | Open in IMG/M |
| 3300031832|Ga0318499_10137496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300031896|Ga0318551_10642274 | Not Available | 613 | Open in IMG/M |
| 3300032035|Ga0310911_10615842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300032041|Ga0318549_10544720 | Not Available | 521 | Open in IMG/M |
| 3300032065|Ga0318513_10238161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300032180|Ga0307471_102107761 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300032180|Ga0307471_102474190 | Not Available | 657 | Open in IMG/M |
| 3300032205|Ga0307472_100604362 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300032205|Ga0307472_101392401 | Not Available | 680 | Open in IMG/M |
| 3300032261|Ga0306920_103549444 | Not Available | 576 | Open in IMG/M |
| 3300032397|Ga0315287_12257038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae | 592 | Open in IMG/M |
| 3300032782|Ga0335082_10119600 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300032829|Ga0335070_10210675 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300032955|Ga0335076_10666740 | Not Available | 922 | Open in IMG/M |
| 3300033004|Ga0335084_10010438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9309 | Open in IMG/M |
| 3300033004|Ga0335084_11570101 | Not Available | 649 | Open in IMG/M |
| 3300033004|Ga0335084_11627102 | Not Available | 636 | Open in IMG/M |
| 3300033550|Ga0247829_11312214 | Not Available | 599 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.14% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat | 1.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.43% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.43% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.43% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.71% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.71% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.71% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014967 | Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9Ka | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1058327892 | 3300000364 | Soil | MAKAPAQPAEEKECCRRTRERWERRIRSYYASFPVIKSVPCDTCREIVEIRVLETPAA* |
| F14TC_1020227712 | 3300000559 | Soil | MAKAPAEPVEEKECCRRTRERWERRIRSYYASFPVIKSVPCDTCREIVEIRVLETPAA* |
| Ga0062589_1008657132 | 3300004156 | Soil | MRGRVRVRNSPFMAEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDECREILEIRVYGLPAA* |
| Ga0066397_100386542 | 3300004281 | Tropical Forest Soil | DEPAEKDCCRRTRERWMARIRAYFTTFPVIKDVPCDECREILEIRVYSQPAA* |
| Ga0063356_1022416243 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRGRVRVRKSPSMTEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDDCREILEIRVYGLPAA* |
| Ga0062592_1001222491 | 3300004480 | Soil | MSEQPAEKDCCRRTRRRWIERIGAYFTSFPVIKDVPCDTCREIIEIR |
| Ga0062591_1006883041 | 3300004643 | Soil | ENWASAWMRGRVRVRNSPFMAEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDECREILEIRVYGLPAA* |
| Ga0066680_105495612 | 3300005174 | Soil | MAEAPVEKECCQRTRERWLTRIRKYFTSFPVIKDVPCDECREILEIRVYDHPAA* |
| Ga0066676_109492771 | 3300005186 | Soil | MADESLEKDCCRRTRERWLARIRAHFTSFPVIKDVPCDECREIIE |
| Ga0066388_1003524991 | 3300005332 | Tropical Forest Soil | MEEKECCRRTRERWERRIRAYYASFPVIKSVPCDTCREILEIRVLEAPVA* |
| Ga0066388_1011325932 | 3300005332 | Tropical Forest Soil | MAEETVEKDCCRRTRERWMTRIRAYFTSFPVIKDVPCDECREIVEIRVYGLPAA* |
| Ga0066388_1014663811 | 3300005332 | Tropical Forest Soil | MADEPVEKECCRRTREQWERRIRAYYASFPVIKNVPCDGCREILEI |
| Ga0066388_1015739182 | 3300005332 | Tropical Forest Soil | MAKALEAVQEKECCRRTRERWERRIRAYYASFPVIKSVPCDTCREILEIRVLEAPVA* |
| Ga0066388_1016931351 | 3300005332 | Tropical Forest Soil | MAEEPVEKECCRRTRAQWERRIRAYYASFPVIKNVPCDGCREILEIRVFETPAA* |
| Ga0066388_1029471712 | 3300005332 | Tropical Forest Soil | MAKAPAQPAEEKECCRRTRERWERRIRSYYASFPVIKSVPCETCREIVEIRVLGAPAA* |
| Ga0066388_1041661752 | 3300005332 | Tropical Forest Soil | MVEAAAEKECCRRTRERWMHRIRSHFTSFPVIKDVPCDECREILEIRVYDWPVA* |
| Ga0066388_1058533972 | 3300005332 | Tropical Forest Soil | MAQDPDEKDCCRRTRERWERRIRAYYASFPVIKDVPCDTCREILEIR |
| Ga0070711_1018696991 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEKECCRRTRERWMARIRKYFTSFPVIKDVPCDECREILEIRVYAQPVA* |
| Ga0070700_1005043771 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDECREILEIR |
| Ga0070694_1018722932 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEQPAEKDCCRRTRRRWIERIRAYFTSFPVIKDVPCDTCREIIEI |
| Ga0070708_1000424884 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MADETAEKDCCRRTRERWLARIRAHFSSFPVIKDVPCDECREIVEIRVYGPSAA* |
| Ga0070708_1015833262 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LGYTRAAMAEADDEKECCRRTRARWMRRIESHFVSLPVIKDVP |
| Ga0066681_100955453 | 3300005451 | Soil | MADEPEKECCRRTRERWMERIRAHFASYPVIKDVPCDQCLEI |
| Ga0070678_1020662312 | 3300005456 | Miscanthus Rhizosphere | MAEDPVEKECCRRTRERWLRRIEAYYTTFPVIKDVPCDGCREILEIRVYGLPAA* |
| Ga0070706_1003051032 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LARTASSATYRPAAMADETAEKECCRRTRERWLARIRSYFTSFPVIKDVPCDDCREIVEIRVYGPSAA* |
| Ga0070706_1005798882 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEIAEKDCCRRTRERWLARIRAHFSSFPVIKDVPCDECREIVEIRVYGPSAA* |
| Ga0070706_1013542132 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEAPVEKECCQRTRDRWLARIRKYFTSFPVIKDVPCDECREILEIRVYEHPAA* |
| Ga0070699_1004300532 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MADETAEKDCCRRTRERWLARIRAHFSSFPVIKDVPCDECR |
| Ga0070741_1000631213 | 3300005529 | Surface Soil | MADSVAEKPCCARTRARWMKRIAAYYASLPVIKDVPCDECREILEIRVYDLPAAE* |
| Ga0070697_1000249945 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEPDHAEKESCRRTRARWMARIRAYFTSFPVIKDVPCDQCRDIIEIGVYGPPEA* |
| Ga0070697_1001339183 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEEVAEKDCCRRTRARWMARIRAYFTSFPVIKDVPCDDCREIVEIRVYRRPAA* |
| Ga0070697_1005726204 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEASDEKPCCARTRARWMKRIARHFTSFPVIKDVPCDECRAILELRVYQQPAA* |
| Ga0070697_1007461492 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MADDAVEKDCCRRTRARWMARIEAYFTSFPVIKDVPCDECREILEIRVYGLPAA* |
| Ga0070696_1013732442 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEATEKDCCRRTRERWIRRIRGYYTSFPVIKDVPCDECREILEIRVYDAA* |
| Ga0066707_100979782 | 3300005556 | Soil | MADEPAEKVWRRRPRERWLVRIRAHFTSFPVIKDVPCDECREIIEIRVYGPSAA* |
| Ga0066707_106759132 | 3300005556 | Soil | MPEPPLEKECCRRTRERWLARIEKYFTSFPVIKDVPCDECREI |
| Ga0066700_108011122 | 3300005559 | Soil | MADEPAEKDCCRRTRERWLDRIRSHFTSFPVIKDVPCDEC |
| Ga0066708_106968022 | 3300005576 | Soil | MADEPAEKECCRRTRERWLARIRAHFTSFPVIKDVPCDEC |
| Ga0068856_1011921531 | 3300005614 | Corn Rhizosphere | MADEKDCCRRTRERWMARIRKYFTSFPVIKDVPCDECREILEIRVYGQPAA* |
| Ga0066905_1003116771 | 3300005713 | Tropical Forest Soil | MAKAPAQPAEEKECCRRTRERWERRIRAYYASFPVIKSVPCDTCREIVEIRVLEAPAA* |
| Ga0066905_1011454001 | 3300005713 | Tropical Forest Soil | MAEEPVEKECCRRTRAQWERRIRAYYASFPVIKNVPCDGCREILEIRVFETP |
| Ga0066905_1017348581 | 3300005713 | Tropical Forest Soil | MAEEPVEKECCRRTRARWERRIRAYYASFPVIKDVPCDG |
| Ga0066905_1017750802 | 3300005713 | Tropical Forest Soil | MAEEPVEKECCRRTRARWERRIRAYYASFPVIKDVPCDGCREILEIRVFETPAA* |
| Ga0066903_1005523433 | 3300005764 | Tropical Forest Soil | MADEPEKECCRRTRERWMERIRAHFTSYPVIKDVPCDQCLEIIEIR |
| Ga0066903_1007490122 | 3300005764 | Tropical Forest Soil | MAEDPVEKECCRRTRTQWERRIRAYYASFPVIKNVPCDGCREILEIRVFETPAA* |
| Ga0066903_1007985402 | 3300005764 | Tropical Forest Soil | MAEEPLEKECCRRTRAQWERRIRAYYASFPVIKNVPCDGCREILEIRVFETPAA* |
| Ga0066903_1016176381 | 3300005764 | Tropical Forest Soil | EEPVEKECCRRTRARWERRIRAYYASFPVIKDVPCDGCREILEIRVFETPAA* |
| Ga0066903_1026385251 | 3300005764 | Tropical Forest Soil | MADDPVEKDCCRRTRERWMARIRAYFTTFPVIKDVPCDECREILEIRVYGQPAA* |
| Ga0066903_1036184221 | 3300005764 | Tropical Forest Soil | MADEPVEKDCCRRTREQWERRIRAYYASFPVIKNVPCDGCREILEIRVF |
| Ga0081455_106720412 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAEDPVEKDCCRRTRERWMRRIEAYYTTFPVIKDVPCDQCREILEIRVYGMPAA* |
| Ga0081539_102276602 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MADETVEKDCCRRTRARWLARIEAYYTSFPVIKDVPCDGCREILEIRVYGLPAA* |
| Ga0079222_122654411 | 3300006755 | Agricultural Soil | EKDCCRRTRERWLARIRAYFTTFPVIKDVPCDECREILEIRVYSRPAA* |
| Ga0066659_105135611 | 3300006797 | Soil | MADEPAEKECCRRTRERWLARIRAHFTSFPVIKDVPCDECR |
| Ga0075431_1019758831 | 3300006847 | Populus Rhizosphere | MSEQPAEKDCCRRTRRRWIERIEAYFTSFPVIKDVPCDTCREIIEIR |
| Ga0075425_1009058131 | 3300006854 | Populus Rhizosphere | MADEPAEKDCCRRTRERWMARIRAYFTTFPVIKDVPC |
| Ga0075425_1025072542 | 3300006854 | Populus Rhizosphere | DEKDCCRRTRERWMARIRAYFVSFPVIKDVPCDECREILEIRVYSSPAA* |
| Ga0075434_1008257792 | 3300006871 | Populus Rhizosphere | MAEDAAEKDCCRRTRERWEKRIRAYYTSFPVIKDVPCDECREILEIRVYDAA* |
| Ga0075426_110616412 | 3300006903 | Populus Rhizosphere | MAEPPVEKECCRRTRARWLARIGKYFTSFPVIKDVPCDECREILEIRVYEHPAA* |
| Ga0075435_1011725322 | 3300007076 | Populus Rhizosphere | MSEQPAEKDCCRRTRRRWIDRIGAYFTSFPVIKDVPCDTCREILE |
| Ga0099827_101881164 | 3300009090 | Vadose Zone Soil | MADEPAEKECCRRTRERWLVRIRAHFTSFPVIKDVPCDECREIIEI |
| Ga0105243_109723912 | 3300009148 | Miscanthus Rhizosphere | MTEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDGCREILEIRVYGLPAA* |
| Ga0111538_123438642 | 3300009156 | Populus Rhizosphere | MSEQPAEKDCCRRTRRRWIERIGAYFTSFPVIKDVPCDTCRE |
| Ga0126374_101492492 | 3300009792 | Tropical Forest Soil | MADEPADKECCRHTRERWMARIRAYFTTFHVIKDVPCDECREILEIRVYSQPAA* |
| Ga0126384_101853813 | 3300010046 | Tropical Forest Soil | MAEEPVEKECCRRTRARWERRIRAYYASFPVIKNVPCDGCREILEIRVFETPAA* |
| Ga0126384_117455092 | 3300010046 | Tropical Forest Soil | MADEPAEKECCRRTRERWMARIRAYFTTFPVIKDVPCDECREILEIRVYSQPAA* |
| Ga0126382_106527482 | 3300010047 | Tropical Forest Soil | VHGGFRYIALRRMADEPAEKDCCRRTRERWMARIRAYFTTFPVIKDVPCDECREILEIRVYSQPAA* |
| Ga0127503_101506472 | 3300010154 | Soil | MATEPVEKDCCRKTRERWERRIRSYYVSFPVIKDVPCDDCREILEIRVFE |
| Ga0134109_103284732 | 3300010320 | Grasslands Soil | MADEPEKECCRRTRERWMERIRAHFASYPVIKDVPCD |
| Ga0134062_107653152 | 3300010337 | Grasslands Soil | MADEPAEKDCCRRTRERWLVRIRAHFTSFPVIKDVPCDECREITEIRVYGPSAA* |
| Ga0126376_102524051 | 3300010359 | Tropical Forest Soil | MEEKECCRRTRERWERRIRAYYASFPVIKSVPCDTCREILEIRVLEAPGA* |
| Ga0126372_103624991 | 3300010360 | Tropical Forest Soil | MADEPAEKECCRRTRERWMARIRAYFTTFPVIKDVPCDECREILEIRVYSEPAA* |
| Ga0126377_121334022 | 3300010362 | Tropical Forest Soil | MEEKECCRRTRERWERRIRAYYASFPVIKSVPCDTCREILEIRVL |
| Ga0126377_131533182 | 3300010362 | Tropical Forest Soil | MAKALEAVQEKECCRRTRERWERRIRAYYASFPVIKNVPCDGCREILEIRVFETPAA* |
| Ga0134125_121599811 | 3300010371 | Terrestrial Soil | MADEPAEKDCCRRTRERWLARIRAYFTSFPVIKDVPCDECREIVEIRVYGLPAA* |
| Ga0136847_104977992 | 3300010391 | Freshwater Sediment | MAEEPQEKDCCRRTRARWMRRIRDYYASFPVIKDVPCDGCRQILEIRVYDVPAVS* |
| Ga0136847_125577132 | 3300010391 | Freshwater Sediment | MAEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDECREIL |
| Ga0134124_105539734 | 3300010397 | Terrestrial Soil | MSDQPAEKDCCRRTRARWIERIGAYFTSFPVIKDVPCDTCRGIIE |
| Ga0134122_102215543 | 3300010400 | Terrestrial Soil | MAEEPVEKECCRRTRERWMRRIEAYYTTFPVIKDVPCDGCREILEIRVYGLPAA* |
| Ga0134123_127396582 | 3300010403 | Terrestrial Soil | MAQEPAEKDCCRRTRERWLARIRAYFTSFPVIKDVPCDECREIVELRVYVLPAA* |
| Ga0137363_111077041 | 3300012202 | Vadose Zone Soil | MADEPAEKECCRRTRERWLARIRAHFTSFPVIKDVPCDECREI |
| Ga0137358_102962892 | 3300012582 | Vadose Zone Soil | MPEPPAEKECCQRTRERWLARIEKYFTSFPVIKDVPCDECR |
| Ga0137410_112710501 | 3300012944 | Vadose Zone Soil | MADEPAEKECCRRTRERWLARIRAHFTSFPVIKDVPCDECREILEIRVY |
| Ga0182827_100122562 | 3300014967 | Microbial Mat | MDEPTDAKECCRRTRERWERRIRAYYASFPVIKDVPCDGCREILEIRVFASPVA* |
| Ga0182827_100382961 | 3300014967 | Microbial Mat | VIEKDCCQRTRVRWAKRIAAYYTSFPVIKDVPCDECRER |
| Ga0134089_103549482 | 3300015358 | Grasslands Soil | MADEPEKECCRRTRERWMERILAHFTSYPVIKDVPCDKCLEI |
| Ga0134089_105287352 | 3300015358 | Grasslands Soil | MPEPPPEKECCQRTRERWLARIEKYFTSFPVIKDVPCDECREILEIRVYGPSAA* |
| Ga0182035_113970272 | 3300016341 | Soil | MAQDPDEKDCCRRTRERWERRIRAYYASFPVIKDVPCDTCREILEIRVFGSPAA |
| Ga0182035_115991161 | 3300016341 | Soil | MAEDPDEKDCCRRTRERWERRIRAYYASFPVIKDVP |
| Ga0182039_122576882 | 3300016422 | Soil | SSCSVESRDTREESRPLMAQEPDEKDCCRRTRERWERRIRTYYASFPVIKDVPCDTCREILEIRVFDSPAA |
| Ga0187779_112307012 | 3300017959 | Tropical Peatland | MAQDPGEKDCCRATRERWERRIRAYYASFPVIKDVPCDTCREILEIRVFDVPAA |
| Ga0187777_109685551 | 3300017974 | Tropical Peatland | MADEPAEKRCCARTRERWVARILACFVSFPVIKDVPCDECREILEIRVYGLPAA |
| Ga0187766_100398362 | 3300018058 | Tropical Peatland | MADEPAEKRCCARTRERWIARIHACFTSFPVIKDVPCDECREILEIRVYGLPAA |
| Ga0066667_115367252 | 3300018433 | Grasslands Soil | MTEQSGEKDCCRRTRERWLARIRAYFTSFPVIKGVPCDECREILEIRVYSRPAA |
| Ga0187892_105009212 | 3300019458 | Bio-Ooze | GMADDVEKDCCRATRERWMKRIRLLYTSFPVIKDVPCEGCREILEIRVFDLPAA |
| Ga0224500_103710571 | 3300022213 | Sediment | MADDEKECCARTRTRWERRIGNHYSSFPVVKDVPCDECRVILEIR |
| Ga0224505_101392333 | 3300022214 | Sediment | MADDEKECCARTRTRWERRIGNHYSSFPVVKDVPCDECRVILEI |
| Ga0207685_108656701 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GRRPLSMAEPPAEKDCCQRTRERWLARIQKYFTSFPVIKDVPCDGCREILEIRVFETPAA |
| Ga0207684_108262841 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MADEIAEKDCCRRTRERWLARIRAHFSSFPVIKDVPCDECREIVEIRVYGPSAA |
| Ga0207684_112824872 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEAPVEKECCQRTRDRWLARIRKYFTSFPVIKDVPCDECREILEIRVYEHPAA |
| Ga0207681_113331892 | 3300025923 | Switchgrass Rhizosphere | MAEDPVEKECCRRTRERWLRRIEAYYTTFPVIKDVPCDGCREILEIRVYGLPAA |
| Ga0207708_105347381 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDECREILEIRV |
| Ga0207702_111023711 | 3300026078 | Corn Rhizosphere | MADEKDCCRRTRERWMARIRKYFTSFPVIKDVPCDECREILEIRVYGQPAA |
| Ga0207674_120672241 | 3300026116 | Corn Rhizosphere | MAEEPAEKDCCRRTRARWMERIGAYFASFPVIKDVP |
| Ga0209154_11570222 | 3300026317 | Soil | MADEPEKECCRRTRERWMERIRAHFASYPVIKDVPCDQCRVYGYPAA |
| Ga0209154_12009562 | 3300026317 | Soil | MPEPPAEKECCQRTRERWLARIEKYFTSFPVIKDVPCDECREIL |
| Ga0209266_11729141 | 3300026327 | Soil | MADEPAEKECCRRTRERWLARIRAHFTSFPVIKDVPCDECREIIE |
| Ga0209157_13912051 | 3300026537 | Soil | MPEPPPEKECCQRTRERWLARIEKYFTSFPVIKDVPCDECREIIEI |
| Ga0209376_10347375 | 3300026540 | Soil | MADEPAEKECCRRTRERWLARIRSHFTSFPVIKDVPC |
| Ga0209253_100960883 | 3300027900 | Freshwater Lake Sediment | MAEPTDAKECCRRTRERWERRIRAYYASFPVIKDVPCDGCREILEIRVFASPVA |
| Ga0247826_115340411 | 3300030336 | Soil | MAEPAEKDCCRRTRERWLARIRAYFTSFPVIKDVPCDECREILEIRVY |
| Ga0299906_1000224010 | 3300030606 | Soil | MTEETAEKECCRRTREQWMRRITHHYTSFPVIKDVPCDGCAVILEIRVYGAPAV |
| Ga0302046_100151751 | 3300030620 | Soil | MTEETAEKECCRRTREQWMRRITHHYTSFPVIKDV |
| Ga0318534_102443172 | 3300031544 | Soil | MAQEPDEKDCCRRTRERWERRIRTYYASFPVIKDVPCDTCREILEIRVFDSPAA |
| Ga0318573_101923603 | 3300031564 | Soil | MAQDPDEKDCCRRTRARWERRIRAYYASFPVIKDVPCD |
| Ga0318496_108422862 | 3300031713 | Soil | MADPADEKDCCRRTRARWRKRIADHFTTFPVIKDVPCDGCRDVLEIRVYDRPAA |
| Ga0307469_107859282 | 3300031720 | Hardwood Forest Soil | MADETVEKDCCRRTRARWMARIEAYYTSFPVIKDVPCDGCREILEIRVYGLPAA |
| Ga0318493_102354371 | 3300031723 | Soil | SSCSVESRDTREESRPLMAQEPDEKDCCRRTRERWERRIRKYYASFPVIKDVPCDTCREILEIRVFDSPAA |
| Ga0307468_1002518042 | 3300031740 | Hardwood Forest Soil | MAEEPVEKECCRRTRERWMRRIEAYYTTFPVIKDVPCDGCREILEIRVYGLPAA |
| Ga0318554_101151701 | 3300031765 | Soil | MPQDPDEKDCCRRTRERWERRIRAYYASFPVIKDVPCDTCREI |
| Ga0318552_102053142 | 3300031782 | Soil | MTEEPVERDCCRRTRERWMARIRAYFTTFPVIKDVPCDECREILELRVYTWPAA |
| Ga0307473_110823162 | 3300031820 | Hardwood Forest Soil | MAEADDEKECCRRTRARWMKRIEAHFVSLPVIKDVPCDECRQILEIRVYDLPAA |
| Ga0307473_112536031 | 3300031820 | Hardwood Forest Soil | MADEPAEKRCCARTRERWIARIRACFTSFPVIKDVPCDECREIVEIRVYGLPAA |
| Ga0318499_101374961 | 3300031832 | Soil | MAQDPDEKDCCRRTRARWERRIRAYYASFPVIKDVPCDTCRE |
| Ga0318551_106422742 | 3300031896 | Soil | MADEPVEKECCRRTRTQWERRIRAYYASFPVIKNVPCDGCREILE |
| Ga0310911_106158422 | 3300032035 | Soil | MAQEPDEKDCCRRTRERWERRIRTYYASFPVIKDVPCDTCREI |
| Ga0318549_105447201 | 3300032041 | Soil | ARRMADEPLEKRCCARTRERWIARIHACFTSFPVIKDVPCDGCREILEIRVYEPPGD |
| Ga0318513_102381612 | 3300032065 | Soil | MAQDPDEKDCCRRTRARWERRIRAYYASFPVIKDVPCDTCR |
| Ga0307471_1021077612 | 3300032180 | Hardwood Forest Soil | MADADPVEKDCCRRTRARWLARIEAYFTSFPVIKDVPCDQCRDIVEIRVYGPPAA |
| Ga0307471_1024741902 | 3300032180 | Hardwood Forest Soil | MAEPPAEKDCCQRTRERWLARIETSGTSVPVIEDVPCDECREILE |
| Ga0307472_1006043621 | 3300032205 | Hardwood Forest Soil | MPEADDEKECCRRTRARWMKRIEAHFVSLPVIKDVPCDECRQILEIRVYDLPAA |
| Ga0307472_1013924012 | 3300032205 | Hardwood Forest Soil | MADADPVEKDCCRRTRARWLARIEAYFTSFPVIKDVPCDKCRQILEIRVYEAESV |
| Ga0306920_1035494441 | 3300032261 | Soil | LWVTWVAMADEPVEKECCRRTRTQWERRIRAYYASFPVIKNVPCDGCREILEIRVFETPA |
| Ga0315287_122570381 | 3300032397 | Sediment | MDEPTDAKECCRQTRERWERRIRAYYASFPVIKDVPCDGCREILEIRVFASPVA |
| Ga0335082_101196002 | 3300032782 | Soil | MVEAAAEKECCRRTIERWNKRIAAYFTAYPVIKDVPCDGCLEILEIRVYEPLEV |
| Ga0335070_102106753 | 3300032829 | Soil | MLSAMVEAAVEKECCRRTIARWNKRIAAYFTAYPVIKDVPCDECLEILEIRVYEPPGG |
| Ga0335076_106667402 | 3300032955 | Soil | MVEAAAEKECCRRTIERWNKRIAAYFTAYPVIKDVPCDGCLEILEIRVYEPPEV |
| Ga0335084_100104389 | 3300033004 | Soil | CRRTIERWNKRIAAYFTAYPVIKDVPCDECLEILEIRVYEPPEA |
| Ga0335084_115701011 | 3300033004 | Soil | MSAPMVEAAAEKDCCRRTIERWNKRIAAYFTAYPVIKDVPCDECLEILEIRVYEPPEL |
| Ga0335084_116271022 | 3300033004 | Soil | MSDQAAEKECCAHTRARWLRRIAACFTTYPVIKDVPCDRCREVLEIRVYGPSAA |
| Ga0247829_113122141 | 3300033550 | Soil | VKGMWARFCGCPWMRGRVRVRTAPSMAEDPVEKDCCRRTRERWLRRIEAYYTTFPVIKDVPCDECREILEIRVYGLPAA |
| ⦗Top⦘ |