Scaffold Ga0135126_10131

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0135126_10131

Scaffold Ga0135126_10131

Overview

Basic Information
Taxon OID	3300014243 Open in IMG/M
Scaffold ID	Ga0135126_10131 Open in IMG/M
Source Dataset Name	Indoor hospital air microbial communities from San Diego, USA - 174_L1_2014-4-30
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	San Diego State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	779
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa

Source Dataset Sampling Location
Location Name	USA: San Diego, California
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065766	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0135126_101312	F065766	N/A	MADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQILQRLPR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.