Basic Information | |
---|---|
Taxon OID | 3300013782 Open in IMG/M |
Scaffold ID | Ga0120045_100085 Open in IMG/M |
Source Dataset Name | Marine microbial communites from Sargasso Sea - Prochlorococcus B258 surface rep 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | UCI |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1603 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Prochlorococcus And Synechococcus Communites From Sargasso Sea And California Currents |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097154 | Metagenome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120045_1000852 | F097154 | AGG | VAVDRRRLRKGDSYTPTSRGPALAKQRAASYRYNKQYKPFRTEQSPGTGGFGSGLETQIMRNQTKQFDRERAESLRPETEIQQSILDKIKTAGYQD* |
⦗Top⦘ |