| Basic Information | |
|---|---|
| Taxon OID | 3300013782 Open in IMG/M |
| Scaffold ID | Ga0120045_100085 Open in IMG/M |
| Source Dataset Name | Marine microbial communites from Sargasso Sea - Prochlorococcus B258 surface rep 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | UCI |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1603 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Prochlorococcus And Synechococcus Communites From Sargasso Sea And California Currents |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097154 | Metagenome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120045_1000852 | F097154 | AGG | VAVDRRRLRKGDSYTPTSRGPALAKQRAASYRYNKQYKPFRTEQSPGTGGFGSGLETQIMRNQTKQFDRERAESLRPETEIQQSILDKIKTAGYQD* |
| ⦗Top⦘ |