| Basic Information | |
|---|---|
| Taxon OID | 3300013413 Open in IMG/M |
| Scaffold ID | Ga0177918_114129 Open in IMG/M |
| Source Dataset Name | Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 607 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Regolith → Regolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guaba Ridge, Luquillo Mountain, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 18.28 | Long. (o) | -65.79 | Alt. (m) | Depth (m) | 7.8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019528 | Metagenome / Metatranscriptome | 229 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0177918_1141291 | F019528 | N/A | VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP* |
| ⦗Top⦘ |