3300013413: Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5

Overview

Basic Information

• IMG/M Taxon OID: 3300013413
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128736 | Gp0206493 | Ga0177918
• Sample Name: Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Wisconsin, Madison
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 72877730
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Regolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico
• Type: Engineered
• Taxonomy: Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Regolith → Regolith Bacterial Community From Guaba Ridge, Luquillo Mountains, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Guaba Ridge, Luquillo Mountain, Puerto Rico
• Coordinates
  • Lat. (^o): 18.28
  • Long. (^o): -65.79
  • Alt. (m): N/A
  • Depth (m): 7.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019528	Metagenome / Metatranscriptome	229	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0177918_114129	All Organisms → cellular organisms → Bacteria	607

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0177918_114129	Ga0177918_1141291	F019528	VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP*