| Basic Information | |
|---|---|
| Family ID | F019528 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 229 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GSTQQQVIQVEYNVNRNVSIVALRDQNGTFGIDIKIKKRFP |
| Number of Associated Samples | 181 |
| Number of Associated Scaffolds | 229 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.44 % |
| % of genes near scaffold ends (potentially truncated) | 99.13 % |
| % of genes from short scaffolds (< 2000 bps) | 88.65 % |
| Associated GOLD sequencing projects | 171 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.563 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.511 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.092 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.78% Coil/Unstructured: 65.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 229 Family Scaffolds |
|---|---|---|
| PF09832 | DUF2059 | 70.74 |
| PF00324 | AA_permease | 7.86 |
| PF01135 | PCMT | 3.06 |
| PF04357 | TamB | 2.18 |
| PF00535 | Glycos_transf_2 | 1.31 |
| PF01850 | PIN | 1.31 |
| PF03734 | YkuD | 1.31 |
| PF00723 | Glyco_hydro_15 | 0.87 |
| PF00266 | Aminotran_5 | 0.87 |
| PF13620 | CarboxypepD_reg | 0.44 |
| PF13601 | HTH_34 | 0.44 |
| PF07593 | UnbV_ASPIC | 0.44 |
| PF13649 | Methyltransf_25 | 0.44 |
| PF04185 | Phosphoesterase | 0.44 |
| PF05163 | DinB | 0.44 |
| PF08281 | Sigma70_r4_2 | 0.44 |
| PF16983 | MFS_MOT1 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 229 Family Scaffolds |
|---|---|---|---|
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 7.86 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 7.86 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 7.86 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 7.86 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 3.06 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 3.06 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 3.06 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 3.06 |
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 2.18 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.31 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.87 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.44 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.56 % |
| Unclassified | root | N/A | 0.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111019|2221142218 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300001084|JGI12648J13191_1034546 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300001137|JGI12637J13337_1018062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300002914|JGI25617J43924_10006131 | All Organisms → cellular organisms → Bacteria | 3706 | Open in IMG/M |
| 3300004082|Ga0062384_100328329 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300004082|Ga0062384_100502722 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300004092|Ga0062389_101257374 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300004092|Ga0062389_101511339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300004092|Ga0062389_103780325 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300004633|Ga0066395_10291532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300005175|Ga0066673_10560978 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005332|Ga0066388_105658695 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005451|Ga0066681_10203953 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005468|Ga0070707_100269637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
| 3300005518|Ga0070699_100948234 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005533|Ga0070734_10058692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2312 | Open in IMG/M |
| 3300005542|Ga0070732_10527088 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005554|Ga0066661_10459504 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005559|Ga0066700_10003581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7206 | Open in IMG/M |
| 3300005569|Ga0066705_10351036 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300005602|Ga0070762_10000528 | All Organisms → cellular organisms → Bacteria | 16255 | Open in IMG/M |
| 3300006032|Ga0066696_11047576 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006050|Ga0075028_100360716 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006052|Ga0075029_100694913 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006102|Ga0075015_100162531 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300006173|Ga0070716_101436581 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006174|Ga0075014_100290651 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006755|Ga0079222_10927203 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006854|Ga0075425_102042758 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300007076|Ga0075435_100882095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300007265|Ga0099794_10063308 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300007265|Ga0099794_10221940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
| 3300007265|Ga0099794_10452173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300007819|Ga0104322_142354 | All Organisms → cellular organisms → Bacteria | 2755 | Open in IMG/M |
| 3300009088|Ga0099830_10323063 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300009088|Ga0099830_10590299 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300009089|Ga0099828_10434030 | Not Available | 1184 | Open in IMG/M |
| 3300009089|Ga0099828_10835626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300009093|Ga0105240_12158830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009137|Ga0066709_101039785 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300010043|Ga0126380_11219048 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010046|Ga0126384_10301993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1316 | Open in IMG/M |
| 3300010046|Ga0126384_10819759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300010048|Ga0126373_11015010 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300010048|Ga0126373_11967970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300010048|Ga0126373_12694207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300010159|Ga0099796_10218328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300010341|Ga0074045_10676259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300010358|Ga0126370_10100680 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
| 3300010359|Ga0126376_10262904 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300010360|Ga0126372_11021682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300010360|Ga0126372_12054154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010360|Ga0126372_12244409 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 595 | Open in IMG/M |
| 3300010360|Ga0126372_13328620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300010361|Ga0126378_10225674 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300010361|Ga0126378_11492276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300010364|Ga0134066_10394053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300010366|Ga0126379_11221166 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300010376|Ga0126381_100984730 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300010858|Ga0126345_1267155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300010880|Ga0126350_11031840 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300011120|Ga0150983_16027428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300011269|Ga0137392_10910571 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012189|Ga0137388_11353955 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012199|Ga0137383_11365853 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012202|Ga0137363_10061161 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300012205|Ga0137362_10621416 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012209|Ga0137379_10348162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1391 | Open in IMG/M |
| 3300012361|Ga0137360_10040604 | All Organisms → cellular organisms → Bacteria | 3292 | Open in IMG/M |
| 3300012361|Ga0137360_10980935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300012363|Ga0137390_11462755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 625 | Open in IMG/M |
| 3300012582|Ga0137358_10090429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2068 | Open in IMG/M |
| 3300012683|Ga0137398_11123272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300012917|Ga0137395_10413862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300012924|Ga0137413_10233594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1254 | Open in IMG/M |
| 3300012925|Ga0137419_10724038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300012927|Ga0137416_10055768 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
| 3300012931|Ga0153915_10423067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
| 3300012960|Ga0164301_10028237 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300012986|Ga0164304_11346171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300013306|Ga0163162_11767851 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300013413|Ga0177918_114129 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300014154|Ga0134075_10583805 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300014164|Ga0181532_10058047 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300014200|Ga0181526_10045360 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
| 3300014501|Ga0182024_11574543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300015054|Ga0137420_1090805 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300015054|Ga0137420_1148933 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300015054|Ga0137420_1361749 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300015054|Ga0137420_1423662 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300015242|Ga0137412_10122774 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300016294|Ga0182041_10328981 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300016404|Ga0182037_11622226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300016445|Ga0182038_10289048 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300016750|Ga0181505_10405674 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300017656|Ga0134112_10492060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300017822|Ga0187802_10422216 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300017823|Ga0187818_10506300 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300017930|Ga0187825_10413991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300017934|Ga0187803_10019842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2681 | Open in IMG/M |
| 3300017955|Ga0187817_10392671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300017974|Ga0187777_10575116 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300017995|Ga0187816_10053264 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300017995|Ga0187816_10169463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300017995|Ga0187816_10467611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300017999|Ga0187767_10196839 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300018007|Ga0187805_10327437 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018062|Ga0187784_10465561 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300019192|Ga0184603_134202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300020199|Ga0179592_10478431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300020579|Ga0210407_10359658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1139 | Open in IMG/M |
| 3300020580|Ga0210403_10316049 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300020581|Ga0210399_10151881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1915 | Open in IMG/M |
| 3300020581|Ga0210399_10348114 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300020581|Ga0210399_10686729 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300020581|Ga0210399_10770761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300020581|Ga0210399_11077950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300020581|Ga0210399_11602034 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020583|Ga0210401_10126641 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300021088|Ga0210404_10151370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300021168|Ga0210406_10826182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300021170|Ga0210400_10120960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2089 | Open in IMG/M |
| 3300021170|Ga0210400_11566506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300021171|Ga0210405_10840403 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300021180|Ga0210396_10679447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300021181|Ga0210388_10075303 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
| 3300021181|Ga0210388_11018998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300021401|Ga0210393_10224820 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300021401|Ga0210393_11204502 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300021404|Ga0210389_11086095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300021407|Ga0210383_11179092 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300021407|Ga0210383_11398306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300021418|Ga0193695_1087988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300021420|Ga0210394_10055701 | All Organisms → cellular organisms → Bacteria | 3448 | Open in IMG/M |
| 3300021432|Ga0210384_10926578 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300021432|Ga0210384_11347814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300021432|Ga0210384_11811411 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300021475|Ga0210392_10309361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1134 | Open in IMG/M |
| 3300021478|Ga0210402_10054909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3489 | Open in IMG/M |
| 3300021478|Ga0210402_10373559 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300021559|Ga0210409_10541298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300021559|Ga0210409_11202744 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300021560|Ga0126371_13504660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021560|Ga0126371_13542765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300022532|Ga0242655_10079632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300022722|Ga0242657_1166238 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300022726|Ga0242654_10120076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300022726|Ga0242654_10122169 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300022726|Ga0242654_10130642 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300023056|Ga0233357_1041393 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300024251|Ga0247679_1017482 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300024287|Ga0247690_1045858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300024288|Ga0179589_10588768 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300024330|Ga0137417_1137503 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300024330|Ga0137417_1195556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300024330|Ga0137417_1233498 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300024330|Ga0137417_1243538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300024330|Ga0137417_1332268 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300024330|Ga0137417_1332269 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300025922|Ga0207646_10440290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1176 | Open in IMG/M |
| 3300026319|Ga0209647_1336646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300026910|Ga0207840_1007578 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300027000|Ga0207803_1034334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300027330|Ga0207777_1013431 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300027587|Ga0209220_1013024 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300027603|Ga0209331_1081631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300027633|Ga0208988_1142818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300027651|Ga0209217_1038637 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300027674|Ga0209118_1053685 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300027680|Ga0207826_1025023 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300027729|Ga0209248_10099232 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300027835|Ga0209515_10375181 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027857|Ga0209166_10464640 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300027862|Ga0209701_10726544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027874|Ga0209465_10594370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10114752 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300028906|Ga0308309_11362868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300030855|Ga0075374_11318150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300030862|Ga0265753_1032242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300031128|Ga0170823_13350072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300031170|Ga0307498_10014564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1667 | Open in IMG/M |
| 3300031231|Ga0170824_100246266 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031474|Ga0170818_115319743 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300031564|Ga0318573_10811647 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031573|Ga0310915_10923490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300031668|Ga0318542_10186603 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300031679|Ga0318561_10698467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031680|Ga0318574_10027428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2846 | Open in IMG/M |
| 3300031715|Ga0307476_10134780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1766 | Open in IMG/M |
| 3300031718|Ga0307474_10057012 | All Organisms → cellular organisms → Bacteria | 2889 | Open in IMG/M |
| 3300031719|Ga0306917_10004068 | All Organisms → cellular organisms → Bacteria | 7674 | Open in IMG/M |
| 3300031720|Ga0307469_10914915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300031723|Ga0318493_10399115 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300031736|Ga0318501_10740749 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031744|Ga0306918_10900694 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300031747|Ga0318502_10094533 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300031763|Ga0318537_10050453 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300031768|Ga0318509_10287102 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031820|Ga0307473_11008297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300031820|Ga0307473_11279150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031820|Ga0307473_11507431 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031859|Ga0318527_10177985 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031893|Ga0318536_10299256 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300031897|Ga0318520_10425967 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031910|Ga0306923_10434826 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300031910|Ga0306923_10771620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300031941|Ga0310912_10876196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300031962|Ga0307479_10034042 | All Organisms → cellular organisms → Bacteria | 4865 | Open in IMG/M |
| 3300031962|Ga0307479_10475897 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300031962|Ga0307479_11043120 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032001|Ga0306922_10675161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300032009|Ga0318563_10381968 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300032010|Ga0318569_10573884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300032035|Ga0310911_10811692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300032041|Ga0318549_10337788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300032052|Ga0318506_10311088 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300032059|Ga0318533_10356185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300032063|Ga0318504_10669321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300032091|Ga0318577_10318209 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300032180|Ga0307471_100160206 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300032180|Ga0307471_100752819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300032205|Ga0307472_102208856 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032261|Ga0306920_101516395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300032783|Ga0335079_10600307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1161 | Open in IMG/M |
| 3300032783|Ga0335079_10670601 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300033004|Ga0335084_12291325 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300033289|Ga0310914_10119464 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300033402|Ga0326728_10826861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300034177|Ga0364932_0220872 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.51% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.06% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.18% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.31% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.31% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.31% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.87% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.87% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.44% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.44% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.44% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.44% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.44% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.44% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.44% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.44% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.44% |
| Regolith | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Regolith | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111019 | Grass soil microbial communities from Rothamsted Park, UK - FP1 and FP2 (Mercury 0.2g/kg) assembled | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013413 | Regolith bacterial community from Guaba Ridge, Luquillo Mountain, Puerto Rico enriched on smectite - SM5 | Engineered | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2221897058 | 2209111019 | Grass Soil | VNSTQQQVIQVEYIVNRNVSVVALLDQNGTFGIDVKIKKRLP |
| JGI12648J13191_10345461 | 3300001084 | Forest Soil | TYISNVGSTQEQVIQVEYNVTRNISVVALRDYNGTFGIDIKIKKRFP* |
| JGI12637J13337_10180621 | 3300001137 | Forest Soil | STQQQVIQVEYNLNRNVSIVALRDQNGTFGIDIKFKKHFQ* |
| JGI25617J43924_100061315 | 3300002914 | Grasslands Soil | NVGSTQQQVIQVEYAVSPTVSIVALRDYNGIFGMDLVIKKRFP* |
| Ga0062384_1003283291 | 3300004082 | Bog Forest Soil | TQEQVIQVEYNVSRNVSIVALRDYNGTFGIDLKIKKRFP* |
| Ga0062384_1005027222 | 3300004082 | Bog Forest Soil | VSSTQQQVIQVEYNVTRSISVVALRDQNGTFGIDVKFKKRLP* |
| Ga0062389_1012573741 | 3300004092 | Bog Forest Soil | NVGSTQQQVIQVEYNVNRNVSIVALRDYNGTFGIDVVIKKRFD* |
| Ga0062389_1015113391 | 3300004092 | Bog Forest Soil | TQQQVIQVEYNLNRNVSIVALRDYNGTFGIDIKFKKHFQ* |
| Ga0062389_1037803252 | 3300004092 | Bog Forest Soil | VSSTQQQVIQVEYNMTRSISIVGLRDQNGTFGIDVKFKKRLP* |
| Ga0066395_102915321 | 3300004633 | Tropical Forest Soil | VSNVGSTQAQVIQVEYNVTRNISIVALRDVNGTFGIDVKIKKRFP* |
| Ga0066673_105609781 | 3300005175 | Soil | TQQQVIQVEYNVNRNVSIVALRDQNGTFGIDFKIKKRFQ* |
| Ga0066388_1056586952 | 3300005332 | Tropical Forest Soil | LNVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP* |
| Ga0066681_102039531 | 3300005451 | Soil | TQQQIIQVEYNVNRNVSVVALRDYNGTFGIDVKIKKRFD* |
| Ga0070707_1002696374 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SSTQQQIIQVEYNVNRNVSVVALRDQNGTFGIDVKIKKRFD* |
| Ga0070699_1009482341 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TQQQVIQVEYNISRRISIVALRDQNGTFGLDVKFKKRFK* |
| Ga0070734_100586921 | 3300005533 | Surface Soil | QEQVIQVEYNVNRNISIVALRDYNGTFGIDVKIKKRFP* |
| Ga0070732_105270882 | 3300005542 | Surface Soil | VSNVSSSQQQVIQVEYNLNRNISIVGLRDQNGTFGVDIKIKKRFP* |
| Ga0066661_104595042 | 3300005554 | Soil | TYVSNVGSTQQQVIQVEYNINRNISIVGLRDYNGTFGIDVKIKNRFP* |
| Ga0066700_100035819 | 3300005559 | Soil | VIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFP* |
| Ga0066705_103510362 | 3300005569 | Soil | VGSTQEQVIQVEYNVNRNISIVALRDYNGTFGIDVKIKKRFP* |
| Ga0070762_1000052816 | 3300005602 | Soil | SNVSSSQQQVIQVEYNLNRNISIVGLRDQNGTFGVDVKIKKRFP* |
| Ga0066696_110475762 | 3300006032 | Soil | IQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFQ* |
| Ga0075028_1003607161 | 3300006050 | Watersheds | QVIQVEYNLNRNISIVGLRDQNGTFGVDIKIKKRFP* |
| Ga0075029_1006949132 | 3300006052 | Watersheds | STQQQVIQVEYIVNRNVSVVALLDQNGTFGIDVKIKKRLQ* |
| Ga0075015_1001625313 | 3300006102 | Watersheds | QVIQVEYNIDRNVSIVALRDQNGTFGIDIKIKKHFQ* |
| Ga0070716_1014365812 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QQVIQVEYNVNRNVSIVALRDQNGTFGIDLKIKKRFR* |
| Ga0075014_1002906511 | 3300006174 | Watersheds | SSTQQQVIQVEYNVTRNISIVGLRDQNGTFGVDIKIKKRFP* |
| Ga0079222_109272031 | 3300006755 | Agricultural Soil | TQEQVIQVEYNVDRNLSIVALRDYNGTFGIDIKIKKHFD* |
| Ga0075425_1020427581 | 3300006854 | Populus Rhizosphere | NSTQQQVIQVEYIVNRNVSVVALLDQNGTFGIDVKIKKRLP* |
| Ga0075435_1008820954 | 3300007076 | Populus Rhizosphere | STQQQVIQVEYNVNRNVSIIALRDYNGTFGIDVKIKKRFD* |
| Ga0099794_100633081 | 3300007265 | Vadose Zone Soil | VIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFR* |
| Ga0099794_102219401 | 3300007265 | Vadose Zone Soil | QQQVIQVEYNVNRNVSIVALRDYNGTFGIDVKIKKRFP* |
| Ga0099794_104521732 | 3300007265 | Vadose Zone Soil | SSSQQQVIQVEYNLNRNISIVGLRDQNGTFGVDIKIKKRFP* |
| Ga0104322_1423541 | 3300007819 | Permafrost Soil | QEQVIQVEYTINRNISVVALRDYNGTFGIDIKIRKRFK* |
| Ga0099830_103230631 | 3300009088 | Vadose Zone Soil | VIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFR* |
| Ga0099830_105902993 | 3300009088 | Vadose Zone Soil | TYVSNVGSTQQQVIQVEYAVSPTVSIVALRDYNGIFGMDLVIKKRFP* |
| Ga0099828_104340301 | 3300009089 | Vadose Zone Soil | IQVEYNVRRNVSIVALRDQNGTFGLDVKFKKRFK* |
| Ga0099828_108356262 | 3300009089 | Vadose Zone Soil | TVTYVSNVGSTQQQVIQVEYAVSPTVSIVALRDYNGIFGMDLVIKKRFP* |
| Ga0105240_121588301 | 3300009093 | Corn Rhizosphere | QEQVIQVEYNVNRNVSIVALRDYNGTFGIDVKIKKRFP* |
| Ga0066709_1010397851 | 3300009137 | Grasslands Soil | QVIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFP* |
| Ga0126380_112190482 | 3300010043 | Tropical Forest Soil | SSTQQQIIQVEYNVNRNISVVALRDQNGTFGVDIKIKKRFD* |
| Ga0126384_103019931 | 3300010046 | Tropical Forest Soil | IQVEYNVNRNVSIVALRDYNGTVGIDVNIKKRCE* |
| Ga0126384_108197591 | 3300010046 | Tropical Forest Soil | VIQVEYNVNRNVSIVALRDQNGTFGIDVKIKKRFN* |
| Ga0126373_110150102 | 3300010048 | Tropical Forest Soil | STQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP* |
| Ga0126373_119679701 | 3300010048 | Tropical Forest Soil | QVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP* |
| Ga0126373_126942071 | 3300010048 | Tropical Forest Soil | NVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP* |
| Ga0099796_102183282 | 3300010159 | Vadose Zone Soil | VIQVEYNVNRNVSIVALRDYNGTFGIDVKIKKRFP* |
| Ga0074045_106762592 | 3300010341 | Bog Forest Soil | IQIEYIVNRNISVVGLRDQNGTFGVDIKFKKRLP* |
| Ga0126370_101006801 | 3300010358 | Tropical Forest Soil | NVSSTQEQVIQVEYNVDRNVSVVGLRDQNGTFGIDIKIKKRF* |
| Ga0126376_102629041 | 3300010359 | Tropical Forest Soil | IQVEYNVNRNVSIVALRDQNGTFGIDIKIKKRFN* |
| Ga0126372_110216822 | 3300010360 | Tropical Forest Soil | VIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRF* |
| Ga0126372_120541541 | 3300010360 | Tropical Forest Soil | STQQQVIQVEYNVERNVSIVGLRDQNGTFGIDIKIKKRF* |
| Ga0126372_122444091 | 3300010360 | Tropical Forest Soil | SSTQQQVIQVEYNVNRNVSIIALRDYNGTFGIDVKIKKRFD* |
| Ga0126372_133286201 | 3300010360 | Tropical Forest Soil | QVIQVEYNVNRNVSIIALRDYNGTFGIDVKIKKRFD* |
| Ga0126378_102256741 | 3300010361 | Tropical Forest Soil | ITYVSNVGSTQQQVIQVEYNVDRSLSIVGLRDQNGTFGIDIKIKKRF* |
| Ga0126378_114922761 | 3300010361 | Tropical Forest Soil | QVIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRF* |
| Ga0134066_103940532 | 3300010364 | Grasslands Soil | IQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFP* |
| Ga0126379_112211662 | 3300010366 | Tropical Forest Soil | VSNVSSTQQQVIQVEYNVTRNISVVALRDQNGTFGVDIKFKKRRP* |
| Ga0126381_1009847302 | 3300010376 | Tropical Forest Soil | STQEQVIQVEYNVDRNVSVVGLRDQNGTFGIDIKIKKRF* |
| Ga0126345_12671552 | 3300010858 | Boreal Forest Soil | QVIQVEYNINRNVSVVVLRDQNGTFGIDIKIKKHFQ* |
| Ga0126350_110318402 | 3300010880 | Boreal Forest Soil | YVSNVGSTQQQVIQVEYNINRNVSVVVLRDQNGTFGIDIKIKKHFQ* |
| Ga0150983_160274281 | 3300011120 | Forest Soil | VIQVEYNIDRNVSIVALRDQNGTFGIDIKIKKHFK* |
| Ga0137392_109105711 | 3300011269 | Vadose Zone Soil | LTITYVSNVSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP* |
| Ga0137388_113539552 | 3300012189 | Vadose Zone Soil | VIQVEYNVNRNVSVVALRDQNGTFGIDIKIKKRFE* |
| Ga0137383_113658531 | 3300012199 | Vadose Zone Soil | TQQQVIQVEYNVDRNVSVVGLRDQNGTFGIDIKIKKRFQ* |
| Ga0137363_100611614 | 3300012202 | Vadose Zone Soil | QVIQVEYNVSRSVSIVALRDYNGTFGIDLKIKKRFP* |
| Ga0137362_106214163 | 3300012205 | Vadose Zone Soil | STQQQIIQVEYNVNRNVSVVALRDQNGTFGIDVKIKKRFD* |
| Ga0137379_103481622 | 3300012209 | Vadose Zone Soil | IQVEYNVNRNVSVVALRDQNGTFGIDVKIKKRFQ* |
| Ga0137360_100406041 | 3300012361 | Vadose Zone Soil | YVSNVGSTQQQVIQVEYNVSRSVSIVALRDYNGTFGIDLKIKKRFP* |
| Ga0137360_109809351 | 3300012361 | Vadose Zone Soil | QVIQVEYAVSPTVSIVALRDYNGIFGMDLVIKKRFP* |
| Ga0137390_114627551 | 3300012363 | Vadose Zone Soil | TQQQIIQVEYNVNRNVSVVALRDQNGTFGIDIKIKKRFD* |
| Ga0137358_100904291 | 3300012582 | Vadose Zone Soil | QVIQVEYNVNRNLSIVALRDYNGTFGIDIKIKKRFP* |
| Ga0137398_111232722 | 3300012683 | Vadose Zone Soil | TQQQIIQVEYNVNRNVSVVALRDQNGTFGIDVKIKKRFD* |
| Ga0137395_104138623 | 3300012917 | Vadose Zone Soil | VIQVEYNVNRNVSIVALRDYNGTFGIDIKIKKRFP* |
| Ga0137413_102335943 | 3300012924 | Vadose Zone Soil | STQQQVIQVEYNVNRNVSIVALRDQNGTFGIDFKIKKRFQ* |
| Ga0137419_107240381 | 3300012925 | Vadose Zone Soil | TQQQVIQVEYNVNRNVSIVALRDYNGTFGIDIKIKKRFP* |
| Ga0137416_100557681 | 3300012927 | Vadose Zone Soil | QVIQVEYHVDRNVSIVGLRDLNGTFGIDIKIKKRFP* |
| Ga0153915_104230671 | 3300012931 | Freshwater Wetlands | IQVEYNVNRNISIVALRDQNGTFGLDVKFKKRFQ* |
| Ga0164301_100282371 | 3300012960 | Soil | TITYVSNVGSTQQQVIQVEYNLDRNISIVALRDQNGTFGIDIKIKKHFQ* |
| Ga0164304_113461712 | 3300012986 | Soil | HLVIHVEYNLDRNISIVALPDQNGTFGIDIKIKKHFQ* |
| Ga0163162_117678512 | 3300013306 | Switchgrass Rhizosphere | VIQVEYNVNRNVSIITLRDYNGTFGIDVKIKKRFD* |
| Ga0177918_1141291 | 3300013413 | Regolith | VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP* |
| Ga0134075_105838052 | 3300014154 | Grasslands Soil | GSTQQQVIQVEYNVNRNVSIVALRDQNGTFGIDIKIKKRFP* |
| Ga0181532_100580474 | 3300014164 | Bog | VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGIDVVFKKRLP* |
| Ga0181526_100453605 | 3300014200 | Bog | SNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGIDVVFKKRLP* |
| Ga0182024_115745431 | 3300014501 | Permafrost | TQEQVIQVEYNVDRNISIVALRDYNGTFGIDIKIKKRFP* |
| Ga0137420_10908051 | 3300015054 | Vadose Zone Soil | GHSSEQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP* |
| Ga0137420_11489331 | 3300015054 | Vadose Zone Soil | IQVEYNVDRNLSIVGLRDQNGTIGIDIKIKRLEST* |
| Ga0137420_13617491 | 3300015054 | Vadose Zone Soil | VSNVTYVSNVSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP* |
| Ga0137420_14236623 | 3300015054 | Vadose Zone Soil | EQITPNLTITYVSNVSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP* |
| Ga0137412_101227741 | 3300015242 | Vadose Zone Soil | QQVIQVEYNLNRNISIVGLRDQNGTFGVDIKIKKRFQ* |
| Ga0182041_103289812 | 3300016294 | Soil | VSSTQQQVIQVEYNVNRNISIVALRDQNGTFGVDIKIKKRFP |
| Ga0182037_116222261 | 3300016404 | Soil | QQVIQVEYNVTRSISIVGLRDQNGTFGVDIKFKKRLP |
| Ga0182038_102890481 | 3300016445 | Soil | QQVIQVEYNVTRTISVVALRDQNGTFGIDIKFKKRLP |
| Ga0181505_104056742 | 3300016750 | Peatland | SNVSSTQQQVIQVEYIVTRSISVVALRDQNGTFGVDIKFKKRLP |
| Ga0134112_104920601 | 3300017656 | Grasslands Soil | QQVIQVEYNVDRSVSIVGLRDQNGTFGIDIKIKKRFQ |
| Ga0187802_104222162 | 3300017822 | Freshwater Sediment | VSNVSSTQQQVIQVEYIVTRTISVVALRDQNGTFGVDIKFKKRFQ |
| Ga0187818_105063001 | 3300017823 | Freshwater Sediment | QVTRNLTITYVSNVSSTQEQVIQVEYNVDRNVSVVALRDQNGTFGIDIKIKKRFQ |
| Ga0187825_104139912 | 3300017930 | Freshwater Sediment | STQQQVIQVEYNVTRSISLVALRDQNGTFGIDVKFKKRLP |
| Ga0187803_100198421 | 3300017934 | Freshwater Sediment | QQVIQVEYNVTRSISVVALRDQNGTFGVDIKIKKRLP |
| Ga0187817_103926711 | 3300017955 | Freshwater Sediment | QQQVIQVEYNVTRSISVVALRDQNGTFGIDVKFKKRLP |
| Ga0187777_105751162 | 3300017974 | Tropical Peatland | QQVIQVEYNVDRNISIVGLRDQNGTFGIDIKIKKRFQ |
| Ga0187816_100532641 | 3300017995 | Freshwater Sediment | PNLTVTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGIDVKFKKRLP |
| Ga0187816_101694631 | 3300017995 | Freshwater Sediment | SNVSSTQQQVIQVEYNVTRSISLVALRDQNGTFGIDVKFKKRLP |
| Ga0187816_104676112 | 3300017995 | Freshwater Sediment | SATQQQVIQVEYNVTRTISVVALRDQNGTFGIDIKFKKRLQ |
| Ga0187767_101968392 | 3300017999 | Tropical Peatland | YVSNVSSTQQQVIQVEYNVDRNISIVGLRDQNGTFGIDIKIKKRFQ |
| Ga0187805_103274372 | 3300018007 | Freshwater Sediment | QEEVIQVEYMVRPDVSIIALRDYNGTFGLDVVFKKRFK |
| Ga0187784_104655611 | 3300018062 | Tropical Peatland | NVSSTQKQVIQVEYNVTRNISVVALRDQNGTFGIDIKFKKRLP |
| Ga0184603_1342022 | 3300019192 | Soil | STQQQVIQVEYNLNRNVSIVALRDQNGTFGIDIKFKKHFQ |
| Ga0179592_104784312 | 3300020199 | Vadose Zone Soil | QVIQVEYNIDRNVSVVALRDQNGTFGIDIKIKKHFQ |
| Ga0210407_103596582 | 3300020579 | Soil | SNVGSTQEQVIQVEYNLNRNISIVALRDYNGTFGIDIKIKKRFP |
| Ga0210403_103160493 | 3300020580 | Soil | STQEQVIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFH |
| Ga0210399_101518813 | 3300020581 | Soil | NVSSTQQQIIQVEYNVNRTVSIVALRDYNGTFGIDVKIKKRFP |
| Ga0210399_103481143 | 3300020581 | Soil | QQQVIQVEYNLNRNISIVGLRDQNGTFGVDIKFKKRFQ |
| Ga0210399_106867291 | 3300020581 | Soil | QQVIQVEYNLNRNISIVGLRDQNGTFGVDIKFKKRFQ |
| Ga0210399_107707612 | 3300020581 | Soil | VGSTQQQVIQVEYNVTRSISIVALRDQNGTFGIDVKIKKRFP |
| Ga0210399_110779501 | 3300020581 | Soil | QQVIQVEYNVTRNISVVALRDYNGTFGIDLVIKKRFH |
| Ga0210399_116020342 | 3300020581 | Soil | RNVTITYISNVGSTQEQVIQVEYNINRNISIVALRDYNGTFGIDIKIKKRFP |
| Ga0210401_101266413 | 3300020583 | Soil | VIQVEYNLNRNVSIVALRDQNGTFGIDIKFKKHFQ |
| Ga0210404_101513701 | 3300021088 | Soil | STQQQVIQVEYNVNRNVSIVALRDYNGTFGIDIKIKKRFQ |
| Ga0210406_108261822 | 3300021168 | Soil | EQVIQVEYNVDRNVSIVGLRDYNGTFGIDVKIKKRFQ |
| Ga0210400_101209601 | 3300021170 | Soil | YVSNVGSTQQQVIQVEYAVSPTVSIVALRDYNGIFGMDLVIKKRFP |
| Ga0210400_115665061 | 3300021170 | Soil | QQVIQVEYIVTRTISIVGLRDQNGTFGVDIKFKKRFP |
| Ga0210405_108404031 | 3300021171 | Soil | NVGSTQQQVIQVEYNLNRNVSIVALRDQNGTFGIDVKFKKHFQ |
| Ga0210396_106794471 | 3300021180 | Soil | GSTQQQVIQVEYNVNRNLSIVALRDYNGTFGIDIKIKKRFP |
| Ga0210388_100753031 | 3300021181 | Soil | VIQVEYNLNRNVSIVALRDQNGTFGIDVKFKKHFQ |
| Ga0210388_110189981 | 3300021181 | Soil | TQEQVIQVEYNVNRNVSIVALRDYNGTFGIDVKIKKRFP |
| Ga0210393_102248203 | 3300021401 | Soil | VIQVEYNVSRNVSIVALRDYNGTFGIDLKIKKRFP |
| Ga0210393_112045021 | 3300021401 | Soil | QVTRNLTITYVSNVGSTQQQVIQVEYNINRNVSVVALRDQNGTFGIDIKIKKHFQ |
| Ga0210389_110860951 | 3300021404 | Soil | TQQQVIQVEYNVNRNVSIVALRDYNGTFGIDVVIKKRFD |
| Ga0210383_111790922 | 3300021407 | Soil | STQQQVIQVEYNLNRNVSIVALRDQNGTFGIDVKFKKHFQ |
| Ga0210383_113983061 | 3300021407 | Soil | QQQVIQVEYNINRNVSIVALRDYNGTFGIDVKFKKHFQ |
| Ga0193695_10879882 | 3300021418 | Soil | QQIIQVEYNVNRQVSVVALRDQNGTFGIDVKIKKRFQ |
| Ga0210394_100557011 | 3300021420 | Soil | RDLTITYVSNVGSTQQQVIQVEYNLNRNVSVVALRDQNGTFGIDIKFKKHFQ |
| Ga0210384_109265781 | 3300021432 | Soil | STQEQVIQVEYNINRNISIVALRDYNGTFGIDIKFKKRFP |
| Ga0210384_113478141 | 3300021432 | Soil | VGSTQEQVIQVEYNVDRNVSIVGLRDYNGTFGIDVKIKKRFQ |
| Ga0210384_118114111 | 3300021432 | Soil | YVSNVGSTQEQVIQVEYTINRNISVVALRDYNGTFGIDIKIRKRFK |
| Ga0210392_103093613 | 3300021475 | Soil | QQQVIQVEYNIDRNVSIVALRDQNGTFGIDIKIKKHFQ |
| Ga0210402_100549091 | 3300021478 | Soil | VSNVGSTQQQVIQVEYIVNRSVSIVGLRDQNGTFGIDVRFKKRLP |
| Ga0210402_103735591 | 3300021478 | Soil | VGSTQQQVIQVEYNVNRNISIVALRDQNGTFGIDVKIKKRFD |
| Ga0210409_105412983 | 3300021559 | Soil | VSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDVKFKKRLP |
| Ga0210409_112027442 | 3300021559 | Soil | VSNVGSTQEQVIQVEYNLNRNISIVALRDYNGTFGIDIKIKKRFP |
| Ga0126371_135046601 | 3300021560 | Tropical Forest Soil | SSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDVKFKKRLP |
| Ga0126371_135427651 | 3300021560 | Tropical Forest Soil | NVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0242655_100796322 | 3300022532 | Soil | GSTQEQVIQVEYNVDRNVSIVGLRDYNGTFGIDIKIKKRF |
| Ga0242657_11662382 | 3300022722 | Soil | SNVGSTQQQVIQVEYNLNRNVSVVALRDQNGTFGIDIKFKKHFQ |
| Ga0242654_101200761 | 3300022726 | Soil | QQQVIQVEYILNRNISIVGLRDQNGTFGVDIKIKKRFP |
| Ga0242654_101221691 | 3300022726 | Soil | QQQVIQVEYNLNRNISVVGLRDQNGTFGVDIKFKKRFQ |
| Ga0242654_101306422 | 3300022726 | Soil | GSTQQQVIQVEYNVNRNVSIVALRDYNGTFGIDIKFKKRFP |
| Ga0233357_10413932 | 3300023056 | Soil | NVGSTQEQVIQVEYTINRNISVVALRDYNGTFGIDIKIRKRFK |
| Ga0247679_10174821 | 3300024251 | Soil | LTITYVSNVGSTQQQVIQVEYNLDRNISIVALRDQNGTFGIDVKIKKHFQ |
| Ga0247690_10458582 | 3300024287 | Soil | TQQQVIQVEYNVNRNVSIVALRDQNGTFGIDFKIKKRFQ |
| Ga0179589_105887682 | 3300024288 | Vadose Zone Soil | NVSSSQQQVIQVEYNLNRNISIVGLRDQNGTFGVDFKFKKRFQ |
| Ga0137417_11375031 | 3300024330 | Vadose Zone Soil | VSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0137417_11955561 | 3300024330 | Vadose Zone Soil | QQQVIQVEYNLNRNINLNRNISIVGLRDQNGTFGVDIKIKKRFQ |
| Ga0137417_12334981 | 3300024330 | Vadose Zone Soil | PSSRSNVSSTQQQVIQVEYNFDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0137417_12435381 | 3300024330 | Vadose Zone Soil | AAGPTQQQVIQVEYNFDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0137417_13322683 | 3300024330 | Vadose Zone Soil | ITYVSNVSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0137417_13322691 | 3300024330 | Vadose Zone Soil | SLMFRNVSNVSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0207646_104402901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QQIIQVEYNVNRNVSIVALRDQNGTFGIDVKIKKRFD |
| Ga0209647_13366462 | 3300026319 | Grasslands Soil | QVIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFP |
| Ga0207840_10075781 | 3300026910 | Tropical Forest Soil | LTVTYVSNVSSTQQQVIQVEYNVTRNISVVALRDQNGTFGVDIKFKKRLP |
| Ga0207803_10343341 | 3300027000 | Tropical Forest Soil | TQQQVIQVEYNVTRNISVVALRDVNGTFGVDIKFKKRRP |
| Ga0207777_10134313 | 3300027330 | Tropical Forest Soil | TQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0209220_10130243 | 3300027587 | Forest Soil | QITPNLTITYVSNVSSTQQQVIQVEYNVDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0209331_10816312 | 3300027603 | Forest Soil | NVGSTQQQVIQVEYNVSRSVSIVALRDYNGTFGIDIIIKKRFP |
| Ga0208988_11428181 | 3300027633 | Forest Soil | QVIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFR |
| Ga0209217_10386373 | 3300027651 | Forest Soil | VGSTQQQVIQVEYAVSPTVSIVALRDYNGIFGIDLVIKKRFP |
| Ga0209118_10536851 | 3300027674 | Forest Soil | ITPNLTITYVSNVSSTQQQVIQVEYNFDRNLSIVGLRDQNGTIGIDIKIKKRFP |
| Ga0207826_10250231 | 3300027680 | Tropical Forest Soil | NVTYVSNVSSTQQQVIQVEYNVTRSISVVALRDQNGTFGVDIKFKKRLP |
| Ga0209248_100992321 | 3300027729 | Bog Forest Soil | SNVGSTQEQVIQVEYNISRNISIVALRDYNGTFGIDIKFKKRFP |
| Ga0209515_103751812 | 3300027835 | Groundwater | QQQVIQVEYNVSRNVSIVALRDQNGTFGLDVKFKKRF |
| Ga0209166_104646402 | 3300027857 | Surface Soil | VTRNLTITYVSNVGSTQQQVIQVEYNLDRNISIVALRDQNGTFGIDIKIKKHFQ |
| Ga0209701_107265441 | 3300027862 | Vadose Zone Soil | QQVTRNLAVTYVSNVSSTQQQVIQVEYNINRNMSLVALRDQNGTFGIDFKIKKRLP |
| Ga0209465_105943701 | 3300027874 | Tropical Forest Soil | TYVSNVGSTQAQVIQVEYNVTRNISIVALRDVNGTFGIDVKIKKRFP |
| (restricted) Ga0233417_101147523 | 3300028043 | Sediment | QQQLIQIEYNVNREVSLIFLRDQNGTFGIDVKFKKRFR |
| Ga0308309_113628682 | 3300028906 | Soil | VIQVEYNINRNISIVALRDYNGTFGIDIKIKKRFP |
| Ga0075374_113181502 | 3300030855 | Soil | MQVIQVEYNVSRNVSIVALRDYNGTFGIDLKIKKRFP |
| Ga0265753_10322422 | 3300030862 | Soil | SNVSSTQQQVIQVEYNVTRNISIVGLRDQNGTFGIDVKFTKRLP |
| Ga0170823_133500721 | 3300031128 | Forest Soil | QQVIQVEYNVSRNVSIVALRDYNGTFGIDLKIKKRFP |
| Ga0307498_100145641 | 3300031170 | Soil | QVIQVEYIVNRNVSVVALLDQNGTFGIDVKIKKRLP |
| Ga0170824_1002462662 | 3300031231 | Forest Soil | VGSTQEQVIQVEYNINRNISIVALRDYNGTFGIDIKFKKRFP |
| Ga0170818_1153197431 | 3300031474 | Forest Soil | VSNVSSSQQQVIQVEYNLNRNISIVGLRDQNGTFGVDVKIKKRFQ |
| Ga0318573_108116472 | 3300031564 | Soil | TQQQVIQVEYNVNRNVSIIALRDYNGTFGIDVKIKKRFD |
| Ga0310915_109234902 | 3300031573 | Soil | SSTQQQVIQVEYNVTRNISVVALRDQNGTFGVDVKFKKRLP |
| Ga0318542_101866031 | 3300031668 | Soil | VSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318561_106984672 | 3300031679 | Soil | TQQQVIQVEYNVTRNISVVALRDQNGTFGVDVKFKKRLP |
| Ga0318574_100274285 | 3300031680 | Soil | TLNVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0307476_101347803 | 3300031715 | Hardwood Forest Soil | QQVQRNLTITYVSNVGSTQQQVIQVEYNVTRNISVVALRDYNGTFGIDLVIKKRFH |
| Ga0307474_100570124 | 3300031718 | Hardwood Forest Soil | ISNVGSTQEQVIQVEYNINRNISIVALRDYNGTFGIDIKFKKRFP |
| Ga0306917_1000406811 | 3300031719 | Soil | SNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGIDIKFKKRLP |
| Ga0307469_109149152 | 3300031720 | Hardwood Forest Soil | QQVTRNLTVTYVSNVGSTQQQVIQVEFNVTRSVSIVTLRDYNGTFGIDIKIKKRFP |
| Ga0318493_103991152 | 3300031723 | Soil | QQVSPTLNVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKRRLP |
| Ga0318501_107407491 | 3300031736 | Soil | TYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0306918_109006941 | 3300031744 | Soil | YVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318502_100945333 | 3300031747 | Soil | VIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318537_100504533 | 3300031763 | Soil | QVSPTLNVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318509_102871022 | 3300031768 | Soil | PNLTVTYVSNVSSTQQQVIQVEYNVTRSISIVGLRDQNGTFGVDIKFKKRLP |
| Ga0307473_110082971 | 3300031820 | Hardwood Forest Soil | QQQIIQVEYNVNRNVSIVALRDYNGTFGIDVKIKKRFQ |
| Ga0307473_112791502 | 3300031820 | Hardwood Forest Soil | QVIQVEYNVNRNVSIVALRDYNGTFGIDIKIKKRFP |
| Ga0307473_115074312 | 3300031820 | Hardwood Forest Soil | VSNVGSTQEQVIQVEYNVNRNISIVALRDYNGTFGVDIKIKKRFP |
| Ga0318527_101779852 | 3300031859 | Soil | YVSNVGSTQQQVIQVEYNVDRSLSIVGLRDQNGTFGIDIKIKKRF |
| Ga0318536_102992561 | 3300031893 | Soil | SNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318520_104259671 | 3300031897 | Soil | VTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0306923_104348261 | 3300031910 | Soil | TSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0306923_107716202 | 3300031910 | Soil | SNVTSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0310912_108761962 | 3300031941 | Soil | LTITYVSNVGSTQQQVIQVEYNVDRSLSIVGLRDQNGTFGIDIKIKKRF |
| Ga0307479_100340425 | 3300031962 | Hardwood Forest Soil | QEQVIQVEYAVTRYISVVTLRDYNGTFGIDIKITKRFK |
| Ga0307479_104758973 | 3300031962 | Hardwood Forest Soil | VIQVEYNVDRNVSVVGLRDQNGTFGIDVKIKKRFQ |
| Ga0307479_110431201 | 3300031962 | Hardwood Forest Soil | VSNVGSTQQQVIQVEYNLDRNVSIVALRDQNGTFGIDIKIKKHFQ |
| Ga0306922_106751613 | 3300032001 | Soil | QVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0318563_103819682 | 3300032009 | Soil | SPTLNVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318569_105738841 | 3300032010 | Soil | SSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0310911_108116921 | 3300032035 | Soil | VIQIEYNLNRNISVVALRDQNGTFGVDIKIKKRLP |
| Ga0318549_103377882 | 3300032041 | Soil | QQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0318506_103110881 | 3300032052 | Soil | QQVSPTLNVTYVSNVSSTQQQVIQVEYLVTRTISIVALRDQNGTFGVDIRFKKRLP |
| Ga0318533_103561851 | 3300032059 | Soil | NVGSTQQQVIQVEYNLDRNISIVALRDQNGTFGIDIKIKKRCP |
| Ga0318504_106693212 | 3300032063 | Soil | SSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0318577_103182091 | 3300032091 | Soil | VTYVSNVSSTQQQVIQVEYNVTRTISVVALRDQNGTFGVDVKFKKRLP |
| Ga0307471_1001602061 | 3300032180 | Hardwood Forest Soil | QVIQVEYNVDRNVSIVGLRDQNGTFGIDIKIKKRFK |
| Ga0307471_1007528191 | 3300032180 | Hardwood Forest Soil | SNVGSTQQQVIQVEYNVNRNVSIVALRDYNGTFGIDLKIKKRFP |
| Ga0307472_1022088561 | 3300032205 | Hardwood Forest Soil | SSQQQVIQVEYNLNRNISIVGLRDQNGTFGVDIKFKKRFQ |
| Ga0306920_1015163952 | 3300032261 | Soil | VIQVEYNVNRNVSIVALRDYNGTFGIDIKIKKRFD |
| Ga0335079_106003073 | 3300032783 | Soil | TQQQVIQVEYNVTRTISVVALRDQNGTFGIDIKFKKRLQ |
| Ga0335079_106706013 | 3300032783 | Soil | LTVTYVSNVSSTQQQVIQVEYNVTRTVSVVALRDQNGTFGIDIKFKKRLP |
| Ga0335084_122913251 | 3300033004 | Soil | PNLTVTYVSNVSSTQQQVIQVEYNVTRNISVVALRDQNGTFGVDIKFKKRRP |
| Ga0310914_101194644 | 3300033289 | Soil | QQVIQVEYNVTRTISVVALRDQNGTFGVDIKFKKRLP |
| Ga0326728_108268612 | 3300033402 | Peat Soil | QVIQVEYNVTRNISVVALRDQNGTFGIDVKFKKRLP |
| Ga0364932_0220872_2_118 | 3300034177 | Sediment | QQQVIQVEYNVNRNVSIVALRDQNGTFGLDIKLKKRFK |
| ⦗Top⦘ |