| Basic Information | |
|---|---|
| Taxon OID | 3300013291 Open in IMG/M |
| Scaffold ID | Ga0120682_1001397 Open in IMG/M |
| Source Dataset Name | Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-07 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Weill Cornell Medical College |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 815 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA:New York City | |||||||
| Coordinates | Lat. (o) | 40.67 | Long. (o) | -73.99 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041807 | Metagenome / Metatranscriptome | 159 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120682_10013971 | F041807 | AGGA | MARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLK |
| ⦗Top⦘ |