Basic Information | |
---|---|
Taxon OID | 3300012921 Open in IMG/M |
Scaffold ID | Ga0164290_1046654 Open in IMG/M |
Source Dataset Name | Contaminated culture microbial community from soil near Moab, Utah, USA - Microcoleus steenstrupii SON62 (Illumina Assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 591 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Desert → Contaminated Culture → Genome Sequencing Of Microcoleus Cyanobacteria Isolates From Utah, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Moab, Utah | |||||||
Coordinates | Lat. (o) | 38.5733 | Long. (o) | -109.5498 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098846 | Metagenome / Metatranscriptome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0164290_10466541 | F098846 | AGGAG | MEPGTERYGVSDIVYDIIQTVGNLLQGQEKLQEYAVDADRAGDQEAAAAFRTIAEANRAGAQVLLGRLRVHLNEHQDYKD* |
⦗Top⦘ |