NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120836_104583

Scaffold Ga0120836_104583


Overview

Basic Information
Taxon OID3300012609 Open in IMG/M
Scaffold IDGa0120836_104583 Open in IMG/M
Source Dataset NameUrban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00357
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWeill Cornell Medical College
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)513
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location
Location NameUSA:New York City
CoordinatesLat. (o)40.52Long. (o)-74.19Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065766Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0120836_1045831F065766GGAMGDEKKDEGAGDPMKILLEEALEKQRNTVMDKFAQILQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.