Scaffold Ga0116696_1036579

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116696_1036579

Scaffold Ga0116696_1036579

Overview

Basic Information
Taxon OID	3300012284 Open in IMG/M
Scaffold ID	Ga0116696_1036579 Open in IMG/M
Source Dataset Name	Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Georgia Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	806
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand → Beach Sand Microbial Communities From Municipal Pensacola Beach, Florida

Source Dataset Sampling Location
Location Name	USA: Municipal Pensacola Beach, FL
Coordinates	Lat. (^o)	30.3262	Long. (^o)	-87.1745	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051932	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116696_10365793	F051932	N/A	MFDITEQDCETITKLRWLQVKELSIKYSNDQEFGAKVRKLINK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.