| Basic Information | |
|---|---|
| Family ID | F051932 |
| Family Type | Metagenome |
| Number of Sequences | 143 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.70 % |
| % of genes near scaffold ends (potentially truncated) | 27.27 % |
| % of genes from short scaffolds (< 2000 bps) | 86.01 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.126 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (30.070 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.524 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 1.40 |
| PF00118 | Cpn60_TCP1 | 0.70 |
| PF12843 | QSregVF_b | 0.70 |
| PF14743 | DNA_ligase_OB_2 | 0.70 |
| PF00303 | Thymidylat_synt | 0.70 |
| PF03767 | Acid_phosphat_B | 0.70 |
| PF01510 | Amidase_2 | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.70 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.70 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.13 % |
| All Organisms | root | All Organisms | 25.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 30.07% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 18.18% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.99% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.20% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 3.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.50% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.50% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 3.50% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.80% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.80% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.10% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.10% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.40% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.40% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.40% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.40% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.40% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.70% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.70% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.70% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.70% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.70% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.70% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.70% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.70% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.70% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.70% |
| Beach Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand | 0.70% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.70% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005820 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011125 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, permeate | Environmental | Open in IMG/M |
| 3300011247 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.02 | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300012284 | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2 | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300019699 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MG | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101441984 | 3300000115 | Marine | MFKLTEQDYETIVKLRWLQVNELAIKYSNDQEFGAQVRKLINK* |
| DelMOSum2011_101593111 | 3300000115 | Marine | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLIKK* |
| DelMOWin2010_100047473 | 3300000117 | Marine | MFDITEQDCETITKLRWLQVKELSIKYSNDQEFGANVRKLINK* |
| DelMOWin2010_100186698 | 3300000117 | Marine | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK* |
| DelMOWin2010_1003250410 | 3300000117 | Marine | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK* |
| BBAY93_101611394 | 3300000973 | Macroalgal Surface | HIMFNVTEQDCETITKLRWLQVKELAIKYSNDQEFGAEIRKLIKK* |
| JGI24006J15134_100998595 | 3300001450 | Marine | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGEAVRKLTKK* |
| JGI24006J15134_101091164 | 3300001450 | Marine | MFNITDQDYDTLTKLRWLQVNELAIKYSNDQEFGAEVKKLIKNTN* |
| JGI24003J15210_100000352 | 3300001460 | Marine | MMDLEKEYGTITKIRWLQINELAIKYPNNQEFGAEVRKLINKNTN* |
| KVRMV2_1012018103 | 3300002231 | Marine Sediment | MTMFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAQVRKLINK* |
| JGI25132J35274_10332432 | 3300002483 | Marine | MFKLNEKDYETITRLRWLQVNELAIKYSNDQEFGEKVRELINK* |
| JGI25133J35611_102077931 | 3300002514 | Marine | MKLNEKDYDTLTKLRWLQVNELALKYSNDAEYGEVVRELTKK* |
| Ga0066223_12588522 | 3300004461 | Marine | MSSSITEQDCETITKLRWLQVKELAIKYSNDQEFGAAVRKLTKK* |
| Ga0073579_15637512 | 3300005239 | Marine | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLTKK* |
| Ga0070728_101820311 | 3300005588 | Marine Sediment | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGSEV |
| Ga0070724_100950885 | 3300005609 | Marine Sediment | MFNLTEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK* |
| Ga0078747_1310935 | 3300005820 | Marine Sediment | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK* |
| Ga0099972_119753322 | 3300006467 | Marine | MFDLRKEYDTITKLRWLQVKTLKDQYPNDQEFGAKVRELINNTN* |
| Ga0098038_12149902 | 3300006735 | Marine | MFDLRKEYDTITKLRWLQVNELAISYPNDQELGAKVRELIKKTK* |
| Ga0098038_12381582 | 3300006735 | Marine | MNLTQEDYDTLTKLRWLQINELAIKYPNDQEFGGKVRQLINNTN* |
| Ga0098037_10759686 | 3300006737 | Marine | MNLTQEDYDTLTKLRWLQVNELAIKYPNDQEFGGKVRQLINNTN* |
| Ga0098037_10830543 | 3300006737 | Marine | MFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAEVRKLIKK* |
| Ga0098037_11211692 | 3300006737 | Marine | MNLTQVDYDTLTKLRWLQVNELAIKYPNDQELGAKVRELIKNTK* |
| Ga0098037_11900792 | 3300006737 | Marine | MNLTQEDYDTLTKLRWLQINELAIKYPNDQEFGAKVRQLINNTN* |
| Ga0098042_10265395 | 3300006749 | Marine | MLNITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAEVRKLINK* |
| Ga0098058_10641966 | 3300006750 | Marine | MFDVTEQDCETITKLRWLQVKELAIKYSNDQEFGAKVRK |
| Ga0098048_10855324 | 3300006752 | Marine | MFDLSEEDCETITKLRWLQVKELAIKYSNDQEFGAQVRKLTKK* |
| Ga0098054_101462913 | 3300006789 | Marine | MKLNERDYDTLTKLRWLQVNELALKYSNDTEYGEVIRELTKK* |
| Ga0098054_12128662 | 3300006789 | Marine | MFDLSEKDCETITKLRWLQVKELAIKYSNDQEFGEQVRKLTKK* |
| Ga0098054_12521622 | 3300006789 | Marine | MLNITDQDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLIKK* |
| Ga0098055_10697463 | 3300006793 | Marine | MFDLSEEDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLTKK* |
| Ga0070754_102745405 | 3300006810 | Aqueous | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGSEVRKLI |
| Ga0070750_100630957 | 3300006916 | Aqueous | MFNLTEQDCETITKLRWLQVKELAIKYSNNQEFGEEVRKLIKK* |
| Ga0070750_101147695 | 3300006916 | Aqueous | MFELRKEYDTITKLRWLQVKELETKYSNDQELGAEVRKLTKK* |
| Ga0098053_10156971 | 3300006923 | Marine | YGSLCKLRWLQVNELALKYGNDQELGEQIRRLTKK* |
| Ga0098041_12329142 | 3300006928 | Marine | MFDINGTREANLTKLRWLQVKELAIKYSNDQEFGAQVRKLTKK* |
| Ga0098036_12743574 | 3300006929 | Marine | QYGSLCKLRWLQVNELALKYGNDQELGEQIRRLTKK* |
| Ga0070753_13652412 | 3300007346 | Aqueous | CETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK* |
| Ga0115566_102778433 | 3300009071 | Pelagic Marine | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGEEVRKLIKK* |
| Ga0115566_104848601 | 3300009071 | Pelagic Marine | QDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK* |
| Ga0115549_12541442 | 3300009074 | Pelagic Marine | MFNLTEQDCETITKLRWLQVKELAIKYSNDQELGAEVRKLIKK* |
| Ga0115545_10502886 | 3300009433 | Pelagic Marine | LTEQDCETITKLRWLQVKELAIKYSNDQELGAEVRKLIKK* |
| Ga0115011_113078581 | 3300009593 | Marine | MFDLNEEDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLINK* |
| Ga0098043_12264951 | 3300010148 | Marine | MNLTEQDYDTLTKLRWLQINELAIKYPNDQEFGGKVRQLINNTN* |
| Ga0098056_10778183 | 3300010150 | Marine | MFDLSEKDCETITKLRWLQVKELAIKYSNDQEFGAKVRKLTKK* |
| Ga0098059_12060305 | 3300010153 | Marine | MFDLTEQDYETITKLRWLQINELAIKYSNDQEFGAEVRKLIKK* |
| Ga0136651_101862194 | 3300010330 | Marine Hydrothermal Vent | EQDCETITKLRWLQVKELAIKHSNDQEFGANVRKLINK* |
| Ga0118731_1000319272 | 3300010392 | Marine | MFDLRKEYDTITKLRWLQVNELALKYSNDQELGSEVRKLIKNTN* |
| Ga0118731_1065937011 | 3300010392 | Marine | DYETITKLRWLQVNELAIKYPNDQEFGEKVRELIKK* |
| Ga0118731_1106702441 | 3300010392 | Marine | MFDLRKEYDTITKLRWLQVNELALKHSNDQELGSEVRKLIKNTK* |
| Ga0118733_1044091133 | 3300010430 | Marine Sediment | MFDLRKEYDTITKLRWLQVNELALKYSNDQELGAKVRELTKNTN* |
| Ga0114934_101290176 | 3300011013 | Deep Subsurface | MFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAQVRKLINK* |
| Ga0114922_103061404 | 3300011118 | Deep Subsurface | MFNVTEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK* |
| Ga0114922_104064983 | 3300011118 | Deep Subsurface | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGEEVRKLIKK* |
| Ga0151663_10596175 | 3300011125 | Marine | MFNITDQDYDTLTKLRWLQVNELAIKYSNDQELGAKVRELIKNTN* |
| Ga0151657_10308161 | 3300011247 | Marine | DITEQNCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK* |
| Ga0151661_104518811 | 3300011261 | Marine | MFDLRKEYDTITKLRWLQVNELALKYSNDQELGSEVRKLIKK* |
| Ga0116696_10365793 | 3300012284 | Beach Sand | MFDITEQDCETITKLRWLQVKELSIKYSNDQEFGAKVRKLINK* |
| Ga0163180_1002350313 | 3300012952 | Seawater | MFKLTEQDYETIVKLRWLQVNELAIKYSNDQEFGAQVRKLIKK* |
| Ga0164320_104150363 | 3300013098 | Marine Sediment | MFDITEQDCETITKLRWLQVKELAIKHSNDQEFGANVRKLINK* |
| Ga0164320_107897671 | 3300013098 | Marine Sediment | CETITKLRWLQVNELAIKYSNDQEFGAEVRKLINK* |
| Ga0181377_10267183 | 3300017706 | Marine | MFDLTEKEQVEVIIKLRWLQVTELAIKYSNDQEFGAEVRKLIKK |
| Ga0181369_10677561 | 3300017708 | Marine | ILHMFKLTDQDYDTLTKLRWLQLNELAIKYTNDQELGAEVRKLIKK |
| Ga0181412_10958901 | 3300017714 | Seawater | MFDLTDQDYDTLTKLRWLQLNELAIKYTNDQELGAEVRKLIAK |
| Ga0181416_11181342 | 3300017731 | Seawater | MLNITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAQVRKLINK |
| Ga0187218_11399063 | 3300017737 | Seawater | MFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAEVRKLIKK |
| Ga0181421_10344281 | 3300017741 | Seawater | KQMFNLTDQDYDTLTKLRWLQLNELAIKYPNDQQFGAEVRKLIKK |
| Ga0181421_10412261 | 3300017741 | Seawater | MMDLEKEYDTITKIRWLQINELAIKYPNNQEFGAEVRKLIKK |
| Ga0181393_10950111 | 3300017748 | Seawater | TRTMLNITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAEVRKLTKK |
| Ga0181392_12378342 | 3300017749 | Seawater | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAAVRKLTKK |
| Ga0187219_10782833 | 3300017751 | Seawater | LMFDIRKEYDTITKLRWLQVNELALKYSNDQELGAKVRELIKNTN |
| Ga0187219_11325972 | 3300017751 | Seawater | MNLTQEDYETITKLRWLQVKELAIKYSNDQELGAAVRKLTKK |
| Ga0187219_12239061 | 3300017751 | Seawater | GIYSCNMNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLIKK |
| Ga0181408_10154431 | 3300017760 | Seawater | SCNMNLTQEDYETITKLRWLQVNELAIKYSNDQELGAAVRKLTKK |
| Ga0181410_11471142 | 3300017763 | Seawater | MMDLEKEYDTITKIRWLQVNELAIKYPNNQEFGAEVRKLIAK |
| Ga0181385_11323982 | 3300017764 | Seawater | MNLTKEDYETMSKLRWLQVNELAIKYPNDQELGAKVRELIKK |
| Ga0181385_12243901 | 3300017764 | Seawater | HTMFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAQVRKLINK |
| Ga0187220_10636944 | 3300017768 | Seawater | MFDITDSMEANLTKLRWLQLKELAIKYSNDQEFGAEVRKLINK |
| Ga0187220_11568854 | 3300017768 | Seawater | MFDLRKDYDTITKLRWLQVNELALKHSNDQELGSEVRKL |
| Ga0187220_12398281 | 3300017768 | Seawater | MFDLTEQDYETITKLRWLQVNELAIKYSNDQEFGAK |
| Ga0181430_10468297 | 3300017772 | Seawater | MNLTQEDYETITKLRWLQVNELAIKYSNDQGLGAAVRKLTKK |
| Ga0181386_10359905 | 3300017773 | Seawater | MFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAQVRKLINK |
| Ga0181395_12640864 | 3300017779 | Seawater | MFETRKEYDTITKLRWLQVNELAISYPNDQELGAKVRELIK |
| Ga0181379_100875012 | 3300017783 | Seawater | MMDLEKEYGTITKVRWLQINELAIKYPNNQEFGAEVRKLINKNTN |
| Ga0181379_12353411 | 3300017783 | Seawater | QEDYETITKLRWLQVNELAIKYSNDQELGAAVRKLTKK |
| Ga0181424_101717283 | 3300017786 | Seawater | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLTKK |
| Ga0193985_10363172 | 3300019699 | Sediment | MFDLTEQNCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK |
| Ga0194014_10059913 | 3300019732 | Sediment | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK |
| Ga0194029_10017966 | 3300019751 | Freshwater | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK |
| Ga0211504_11114382 | 3300020347 | Marine | MFDLTEQDYETMCKLRWLQVNELAIKYTNDQELGAKVRQLIKK |
| Ga0211576_100231002 | 3300020438 | Marine | MFDLRKDYDTITKLRWLQVNELALKHSNDQELGSEVRKLIKNTK |
| Ga0211576_100808484 | 3300020438 | Marine | MFKLTEQDYETIVKLRWLQVNELAIKYSNDQEFGAQVRKLINK |
| Ga0211577_102744863 | 3300020469 | Marine | MMDLEKEYDTITKVRWLQINELAIKYPNNQEFGAEVRKLINKNTN |
| Ga0213862_100510725 | 3300021347 | Seawater | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK |
| Ga0213863_102242032 | 3300021371 | Seawater | MNLTQEDCETISKLRWLQVNELAIKYSNDQEFGAKVRELINK |
| Ga0226832_103799183 | 3300021791 | Hydrothermal Vent Fluids | MFDLSEEDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLINK |
| Ga0212024_10538743 | 3300022065 | Aqueous | MFNLTEQDCETITKLRWLQVKELAIKYSNNQEFGEEVRKLIKK |
| Ga0212024_10631092 | 3300022065 | Aqueous | MTEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK |
| Ga0212021_10219472 | 3300022068 | Aqueous | MFELRKEYDTITKLRWLQVKELETKYSNDQELGAEVRKLTKK |
| Ga0196891_10062879 | 3300022183 | Aqueous | IILPMFDITEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK |
| Ga0224509_102998012 | 3300022306 | Sediment | MNLTQEDYETITKLRWLQVKELAIKYSNDQEFGAAVRKLTKK |
| (restricted) Ga0233411_101259253 | 3300023112 | Seawater | QDCETITKLRWLQVKELAIKYSNDQELGAEVRKLIKK |
| (restricted) Ga0233410_100865143 | 3300023276 | Seawater | MNLTQEDCETITKLRWLQVKELAIKYSNDQELGAAVRKLTKK |
| (restricted) Ga0255051_102284843 | 3300024057 | Seawater | MNLTQEDCETITKLRWLQVKELAIKYSNDQEFGAEIRKLTKK |
| (restricted) Ga0255040_100861504 | 3300024059 | Seawater | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK |
| (restricted) Ga0255046_101826332 | 3300024519 | Seawater | MTEQDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK |
| (restricted) Ga0255044_103292421 | 3300024529 | Seawater | LQMFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK |
| Ga0207896_10383605 | 3300025071 | Marine | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGAEIRKLIK |
| Ga0208157_10316374 | 3300025086 | Marine | MNLTQEDYDTLTKLRWLQINELAIKYPNDQEFGAKVRQLINNTN |
| Ga0208157_10597682 | 3300025086 | Marine | MFDLRKEYDTITKLRWLQVNELAISYPNDQELGAKVRELIKKTK |
| Ga0208669_10446732 | 3300025099 | Marine | MFKLTDQDYDTLTKLRWLQLNELAAKYTNDQELGAEVRKLIKK |
| Ga0208159_100058325 | 3300025101 | Marine | MNLTQEDYDTLTKLRWLQINELAIKYPNDQEFGGKVRQLINNTN |
| Ga0208666_10584626 | 3300025102 | Marine | MMNTEFLEYDTLAKLRWLQVNELAIKYPNDQDLGAE |
| Ga0208666_11478053 | 3300025102 | Marine | MLNITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAEVRKLINK |
| Ga0208013_10677362 | 3300025103 | Marine | MKLNERDYDTLTKLRWLQVNELALKYSNDTEYGEVIRELTKK |
| Ga0209535_10001052 | 3300025120 | Marine | MFDLTDQDYDTLTKLRWLQLNELAIKYTNDQELGAEVRKLIKK |
| Ga0209535_100214827 | 3300025120 | Marine | MMDLEKEYGTITKIRWLQINELAIKYPNNQEFGAEVRKLINKNTN |
| Ga0209535_11376803 | 3300025120 | Marine | IILPMFNITEQDCETITKLRWLQVKELAIKYSNDQEFGEAVRKLTKK |
| Ga0209535_12156092 | 3300025120 | Marine | MNLTQEDYETITKLRWLQVNELTIKYSNDQELGAAVRKLTKK |
| Ga0209645_101432312 | 3300025151 | Marine | MFKLNEKDYETITRLRWLQVNELAIKYSNDQEFGEKVRELINK |
| Ga0209337_10370415 | 3300025168 | Marine | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGEAVRKLTKK |
| Ga0209337_12996481 | 3300025168 | Marine | DITEQDCETITKLRWLQVKELAIKYSNDQEFGAEIRKLIKK |
| Ga0209194_10904002 | 3300025632 | Pelagic Marine | MFNLTEQDCETITKLRWLQVKELAIKYSNDQELGAEVRKLIKK |
| Ga0208645_10724506 | 3300025853 | Aqueous | MKEDMTEQDCETITKLRWLQVKELAIKYSNDQEFGSEVRKLIKK |
| Ga0208645_12279994 | 3300025853 | Aqueous | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLTK |
| Ga0209666_14031851 | 3300025870 | Marine | MFDITEQDCETITKLRWLQVKELAIKYSNDQEFGAE |
| Ga0209121_1002564311 | 3300027742 | Marine | MNLTQEDYETITKLRWLQVNELAIKYSNDQELGAAVRKLTKK |
| Ga0209345_102549712 | 3300027852 | Marine | MNLTQEDYETITKLRWLQVKELAIKYSNDQEFGAEVRKLIKK |
| Ga0209013_101856394 | 3300027858 | Marine | MFDLRKDYDTITKLRWLQVKTLHEQYPNDQELGAKVRELIKNTN |
| Ga0209013_104552573 | 3300027858 | Marine | CNMNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLTKK |
| Ga0209013_105326162 | 3300027858 | Marine | CNMNLTQEDYETITKLRWLQVNELAIKYSNDQELGAAVRKLTKK |
| Ga0209404_107975072 | 3300027906 | Marine | MFDLNEKDYETITKIRWLQVNELAIKYSNDQEFGAQVRKLIKK |
| Ga0209165_100327596 | 3300027978 | Marine Sediment | MNLTQEDYETITKLRWLQVNELAIKYSNDQEFGAEVRKLIKK |
| Ga0256382_11072101 | 3300028022 | Seawater | MFDITDQDYDTLTKLRWLQLNELAIKYSNDQEFGAEVRKLINK |
| Ga0256382_11766061 | 3300028022 | Seawater | MSRRMNDQDYDTLTKLRWLQLNELAIKYSNDQEFGAQVRKLS |
| Ga0228645_11455161 | 3300028128 | Seawater | YETITKLRWLQVNELAIKYSNDQEFGAEVRKLIKK |
| Ga0265303_109585253 | 3300028600 | Sediment | MFDLTEQDCETITKLRWLQVKELAIKYSNDQEFGEEVRKLIKK |
| Ga0315322_107056173 | 3300031766 | Seawater | MNLTQEDYETITKLRWLQVKELAIKYSNDQEFGAEVRKLTKK |
| Ga0315320_109622212 | 3300031851 | Seawater | TQEDYGTITKLRWLQVKELAIKYSNDQEFGAEVRKLTKK |
| Ga0315316_102533403 | 3300032011 | Seawater | MFDLSEEDCETITKLRWLQVKELAIKYSNDQEFGAEVRKLTKK |
| Ga0315315_100099079 | 3300032073 | Seawater | MFDITDQDYDTLTKLRWLQVNELAIKYSNNQEFGKEVRRLIKK |
| Ga0315315_108539242 | 3300032073 | Seawater | MFNLTDQDYDTLTKLRWLQLNELAIKYPNDQQFGAEVRKLIKK |
| Ga0315321_102422243 | 3300032088 | Seawater | MNLTQEDYGTITKLRWLQVKELAIKYSNDQEFGAEVRKLTKK |
| ⦗Top⦘ |