Scaffold Ga0120380_1003387

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120380_1003387

Scaffold Ga0120380_1003387

Overview

Basic Information
Taxon OID	3300011989 Open in IMG/M
Scaffold ID	Ga0120380_1003387 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from Wyoming, USA - O_aries_Con_7429
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Missouri
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9504
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (23.53%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	41.314168	Long. (^o)	-105.584589	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097585	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120380_10033872	F097585	GGA	MSEIHYIEENLPHKVSEVICVGCGKRWIAVRPMSTLLKDLECPQCGKQGYVIETGEIIDNEEPF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.