Scaffold Ga0120086_100313

Overview

Basic Information

• Taxon OID: 3300011738
• Scaffold ID: Ga0120086_100313
• Source Dataset Name: Mine pit pond microbial communities from Vermont, USA - 1M
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Vermont
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6160
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond → Mine Pit Pond Microbial Communities From Vermont, Usa

Source Dataset Sampling Location

• Location Name: USA: Vermont
• Coordinates
  • Lat. (^o): 43.727094
  • Long. (^o): -72.425964

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083438	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120086_1003134	F083438	GGAGG	MKKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGAAKPGKKVKK*