| Basic Information | |
|---|---|
| Family ID | F083438 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKKGTQAPAPMSKPVEGSKAGDKVTGGKVMAPFAGAAKPGKKVKK |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.58 % |
| % of genes near scaffold ends (potentially truncated) | 8.85 % |
| % of genes from short scaffolds (< 2000 bps) | 61.95 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.12 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.442 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (23.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.168 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.912 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.12 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 2.65 |
| PF13252 | DUF4043 | 2.65 |
| PF00535 | Glycos_transf_2 | 0.88 |
| PF03796 | DnaB_C | 0.88 |
| PF01930 | Cas_Cas4 | 0.88 |
| PF01391 | Collagen | 0.88 |
| PF04545 | Sigma70_r4 | 0.88 |
| PF12705 | PDDEXK_1 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.88 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.88 |
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.37 % |
| Unclassified | root | N/A | 33.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001371|BBDRAFT_10264256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1281 | Open in IMG/M |
| 3300001687|WOR8_10023612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 6013 | Open in IMG/M |
| 3300001836|RCM27_1006818 | Not Available | 586 | Open in IMG/M |
| 3300001842|RCM30_1013266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1756 | Open in IMG/M |
| 3300001847|RCM41_1132351 | Not Available | 727 | Open in IMG/M |
| 3300001848|RCM47_1164051 | Not Available | 546 | Open in IMG/M |
| 3300001849|RCM26_1029901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1202 | Open in IMG/M |
| 3300001850|RCM37_1036563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 755 | Open in IMG/M |
| 3300001851|RCM31_10022463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 779 | Open in IMG/M |
| 3300002092|JGI24218J26658_1005880 | Not Available | 2423 | Open in IMG/M |
| 3300002098|JGI24219J26650_1006834 | All Organisms → Viruses → Predicted Viral | 2176 | Open in IMG/M |
| 3300002212|metazooDRAFT_1358544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 587 | Open in IMG/M |
| 3300002447|JGI24768J34885_10005337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4212 | Open in IMG/M |
| 3300002930|Water_102926 | All Organisms → Viruses → Predicted Viral | 2860 | Open in IMG/M |
| 3300004448|Ga0065861_1017057 | Not Available | 2454 | Open in IMG/M |
| 3300004460|Ga0066222_1021859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 938 | Open in IMG/M |
| 3300004461|Ga0066223_1008700 | Not Available | 627 | Open in IMG/M |
| 3300004461|Ga0066223_1008701 | Not Available | 594 | Open in IMG/M |
| 3300004461|Ga0066223_1032257 | Not Available | 658 | Open in IMG/M |
| 3300004481|Ga0069718_10078161 | All Organisms → Viruses → Predicted Viral | 1769 | Open in IMG/M |
| 3300004481|Ga0069718_14978585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 635 | Open in IMG/M |
| 3300004481|Ga0069718_15607431 | Not Available | 586 | Open in IMG/M |
| 3300004481|Ga0069718_16299361 | All Organisms → Viruses → Predicted Viral | 1811 | Open in IMG/M |
| 3300004693|Ga0065167_1039107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 768 | Open in IMG/M |
| 3300004775|Ga0007798_10063456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 823 | Open in IMG/M |
| 3300004804|Ga0007796_10002530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 7052 | Open in IMG/M |
| 3300005525|Ga0068877_10458860 | Not Available | 710 | Open in IMG/M |
| 3300006030|Ga0075470_10049401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1290 | Open in IMG/M |
| 3300006802|Ga0070749_10000749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 21771 | Open in IMG/M |
| 3300006802|Ga0070749_10450742 | Not Available | 705 | Open in IMG/M |
| 3300006803|Ga0075467_10654256 | Not Available | 536 | Open in IMG/M |
| 3300006875|Ga0075473_10299287 | Not Available | 651 | Open in IMG/M |
| 3300008072|Ga0110929_1002213 | Not Available | 31960 | Open in IMG/M |
| 3300009009|Ga0105105_10201610 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300009081|Ga0105098_10093246 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300009082|Ga0105099_10012301 | All Organisms → Viruses → Predicted Viral | 4341 | Open in IMG/M |
| 3300009151|Ga0114962_10002058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 17091 | Open in IMG/M |
| 3300009151|Ga0114962_10004065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11709 | Open in IMG/M |
| 3300009151|Ga0114962_10004439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 11169 | Open in IMG/M |
| 3300009151|Ga0114962_10109800 | All Organisms → Viruses → Predicted Viral | 1705 | Open in IMG/M |
| 3300009151|Ga0114962_10163129 | All Organisms → Viruses → Predicted Viral | 1330 | Open in IMG/M |
| 3300009164|Ga0114975_10124025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1487 | Open in IMG/M |
| 3300009169|Ga0105097_10107724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1525 | Open in IMG/M |
| 3300009180|Ga0114979_10657392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 596 | Open in IMG/M |
| 3300009182|Ga0114959_10004617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 10509 | Open in IMG/M |
| 3300009183|Ga0114974_10002418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 14318 | Open in IMG/M |
| 3300009183|Ga0114974_10034606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3467 | Open in IMG/M |
| 3300009184|Ga0114976_10391916 | Not Available | 728 | Open in IMG/M |
| 3300009184|Ga0114976_10709448 | Not Available | 504 | Open in IMG/M |
| 3300009450|Ga0127391_1000489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 8447 | Open in IMG/M |
| 3300010157|Ga0114964_10035771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2693 | Open in IMG/M |
| 3300010354|Ga0129333_11020424 | Not Available | 694 | Open in IMG/M |
| 3300010388|Ga0136551_1011041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1869 | Open in IMG/M |
| 3300010885|Ga0133913_10102142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 7679 | Open in IMG/M |
| 3300010885|Ga0133913_10276778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4451 | Open in IMG/M |
| 3300010885|Ga0133913_10747278 | All Organisms → Viruses → Predicted Viral | 2554 | Open in IMG/M |
| 3300010885|Ga0133913_11189693 | Not Available | 1956 | Open in IMG/M |
| 3300011116|Ga0151516_10262 | Not Available | 29636 | Open in IMG/M |
| 3300011335|Ga0153698_1483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 16479 | Open in IMG/M |
| 3300011738|Ga0120086_100313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 6160 | Open in IMG/M |
| 3300012352|Ga0157138_1016032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1211 | Open in IMG/M |
| 3300012665|Ga0157210_1004648 | All Organisms → Viruses → Predicted Viral | 2895 | Open in IMG/M |
| 3300013286|Ga0136641_1014748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2498 | Open in IMG/M |
| 3300014711|Ga0134314_102429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1320 | Open in IMG/M |
| 3300014962|Ga0134315_1001331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 4697 | Open in IMG/M |
| 3300014962|Ga0134315_1012823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1320 | Open in IMG/M |
| 3300014962|Ga0134315_1020409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1027 | Open in IMG/M |
| 3300014962|Ga0134315_1028848 | Not Available | 860 | Open in IMG/M |
| 3300014962|Ga0134315_1074160 | Not Available | 521 | Open in IMG/M |
| 3300017754|Ga0181344_1052862 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300017754|Ga0181344_1142246 | Not Available | 686 | Open in IMG/M |
| 3300017785|Ga0181355_1052166 | All Organisms → Viruses → Predicted Viral | 1736 | Open in IMG/M |
| 3300017785|Ga0181355_1075839 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300021438|Ga0213920_1002235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 9423 | Open in IMG/M |
| 3300021438|Ga0213920_1014640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2122 | Open in IMG/M |
| 3300021438|Ga0213920_1022631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1529 | Open in IMG/M |
| 3300021438|Ga0213920_1026090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1375 | Open in IMG/M |
| 3300021519|Ga0194048_10110451 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300021952|Ga0213921_1019368 | Not Available | 1162 | Open in IMG/M |
| 3300021956|Ga0213922_1048443 | Not Available | 952 | Open in IMG/M |
| 3300022747|Ga0228703_1037396 | Not Available | 1394 | Open in IMG/M |
| 3300022752|Ga0214917_10002056 | Not Available | 25093 | Open in IMG/M |
| 3300023174|Ga0214921_10191683 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
| 3300023184|Ga0214919_10006361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 16266 | Open in IMG/M |
| 3300024289|Ga0255147_1000344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 14930 | Open in IMG/M |
| 3300024509|Ga0255175_1101686 | Not Available | 502 | Open in IMG/M |
| 3300024561|Ga0255288_1077422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 745 | Open in IMG/M |
| 3300024573|Ga0256337_1181231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 522 | Open in IMG/M |
| 3300025616|Ga0208613_1011583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 2336 | Open in IMG/M |
| 3300026571|Ga0255289_1161903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 503 | Open in IMG/M |
| 3300027693|Ga0209704_1093881 | Not Available | 849 | Open in IMG/M |
| 3300027708|Ga0209188_1000663 | Not Available | 32128 | Open in IMG/M |
| 3300027708|Ga0209188_1001651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 17445 | Open in IMG/M |
| 3300027708|Ga0209188_1008843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 5893 | Open in IMG/M |
| 3300027708|Ga0209188_1053800 | Not Available | 1774 | Open in IMG/M |
| 3300027712|Ga0209499_1328591 | Not Available | 512 | Open in IMG/M |
| 3300027734|Ga0209087_1001671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 12952 | Open in IMG/M |
| 3300027734|Ga0209087_1007143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5899 | Open in IMG/M |
| 3300027749|Ga0209084_1009580 | Not Available | 5966 | Open in IMG/M |
| 3300027759|Ga0209296_1001197 | Not Available | 20535 | Open in IMG/M |
| 3300027792|Ga0209287_10013496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 3011 | Open in IMG/M |
| 3300027792|Ga0209287_10025238 | All Organisms → Viruses → Predicted Viral | 2154 | Open in IMG/M |
| 3300027836|Ga0209230_10270599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 979 | Open in IMG/M |
| 3300027899|Ga0209668_10977320 | Not Available | 571 | Open in IMG/M |
| 3300027969|Ga0209191_1073689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 1505 | Open in IMG/M |
| 3300028025|Ga0247723_1001129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 16119 | Open in IMG/M |
| 3300030943|Ga0311366_11600433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 558 | Open in IMG/M |
| 3300031565|Ga0307379_11159885 | Not Available | 644 | Open in IMG/M |
| 3300031578|Ga0307376_10997555 | Not Available | 505 | Open in IMG/M |
| 3300031857|Ga0315909_10422918 | Not Available | 947 | Open in IMG/M |
| 3300031902|Ga0302322_103999402 | Not Available | 503 | Open in IMG/M |
| 3300033994|Ga0334996_0281891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 837 | Open in IMG/M |
| 3300034061|Ga0334987_0390729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 885 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.19% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 6.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 6.19% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 5.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.42% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.42% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.42% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.42% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.65% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.77% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.77% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.77% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.89% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.89% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.89% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.89% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.89% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.89% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.89% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.89% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.89% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.89% |
| Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004775 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA17M | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011738 | Mine pit pond microbial communities from Vermont, USA - 1M | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBDRAFT_102642562 | 3300001371 | Marine Estuarine | MNKGTQAPASMSKPIHGAAGAGARVTGGEVKQPFAGTPKPGKKVKK* |
| WOR8_100236122 | 3300001687 | Marine Sediment | MKKGTQAPAPMSKPVEGSKAGDKVSGGKVMAPFAGAAKPGKKVKK* |
| RCM27_10068181 | 3300001836 | Marine Plankton | GTHASAPMSKPVEGSKAGDKVTGGKVYQPFAGAAKPGKKVKKG* |
| RCM30_10132662 | 3300001842 | Marine Plankton | MKKGTHAAAPMSKPVEGKKAGDKVTGGKVYQPFAGAAKPGKKVKKG* |
| RCM41_11323513 | 3300001847 | Marine Plankton | MKKGTSPAAPMSKPVEGKKEGDKVQGGKVYQPFAGAAKPGKKVKKG* |
| RCM47_11640512 | 3300001848 | Marine Plankton | VRKGTSAAAPMSKPVEGKKEGDKVQGGKVYQPFAGAAKPGKKVKKG* |
| RCM26_10299012 | 3300001849 | Marine Plankton | MKKGTHAPAPMSKPVEGSKAGDKVTGGKVYQPFAGAAKPGKKVKKG* |
| RCM37_10365632 | 3300001850 | Marine Plankton | MKKGTHAPAPMSKPVEGTKAGDKVTGGKVYQPFAGAAKPGKKVKKG* |
| RCM31_100224632 | 3300001851 | Marine Plankton | MKKGTHAAAPMSKPVEGSKAGDKVTGGKVYQPFAGAAKPGKKVKKG* |
| JGI24218J26658_10058804 | 3300002092 | Lentic | MNKGSQAPAPMSKPVEGKTAGDKVTGGKVYQPFAGAAKSGKKVKK* |
| JGI24219J26650_10068342 | 3300002098 | Lentic | MNKGSQAPAPMAKPIHGAAGAGAKVTGGDVKQPFAGAAKPGKSVKK* |
| metazooDRAFT_13585441 | 3300002212 | Lake | MKKGTHAPAPMSKPVEGKKGGDKVSGGEVKKPFAGTPKPGKKVKKG* |
| JGI24768J34885_100053374 | 3300002447 | Freshwater And Sediment | MKKGTHAPASMSKPTEGAMGATTKVAGGKVEQPYTAAARPGKKVKK* |
| Water_1029265 | 3300002930 | Estuary Water | MNKGSQAPAPMSKPIHGASGAGAKVTGGKVEMPFAGAAKPGKKVKK* |
| Ga0065861_10170572 | 3300004448 | Marine | MNKGSQAPAPMAKPIHGTAGAGAKVTGGDVKMPFAGAAKPGKAVKK* |
| Ga0066222_10218592 | 3300004460 | Marine | MNKGTQAPAPMSKPVHGAAGAGAKVTGGDVKMPFAGAAKPGKMVKKGK* |
| Ga0066223_10087002 | 3300004461 | Marine | MNKGSQAPAPMAKPIHGTAGAGAKVTGGKVEMPFAGAAKPGKAVKK* |
| Ga0066223_10087012 | 3300004461 | Marine | MNKGSQAPAPMSKPIHGAAGAGAKVTGGDVKMPFAGAAKPGKMVKKGK* |
| Ga0066223_10322572 | 3300004461 | Marine | MNKGSQAPAPMSKPIHGAAGAGAKVTGGKVEMPFAGAAKPGKKVKK* |
| Ga0069718_100781612 | 3300004481 | Sediment | MKKGTQAPASMSKPTEGAMGSTTKVAGGKVMAPFAGTPKPGTMVKKSK* |
| Ga0069718_149785851 | 3300004481 | Sediment | MKKGTQAPAPMSKPVEGSKAGDKVTGGKVYQPFAGTPKPGK |
| Ga0069718_156074311 | 3300004481 | Sediment | MKKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGTPKPGTMVKKSK* |
| Ga0069718_162993614 | 3300004481 | Sediment | MNKGSQAPAPMSKPIHGAAGAGAKVTGGAVKQPFAGTPKPGKKVKK* |
| Ga0065167_10391072 | 3300004693 | Freshwater | MKKGTQAAAPMSKPTEGAMGSATKVSGGKVTIPFAGAPKPGKMVKKSK* |
| Ga0007798_100634562 | 3300004775 | Freshwater | MKKGTQAAAPMSKPTEGAMGSATKVSGGKVTIPFAGTPKPGKMVKKSK* |
| Ga0007796_100025302 | 3300004804 | Freshwater | MRKGTHAPASMAKPVEGKKEGDKVQGGKVMEPFAGAAKPGKKVKKG* |
| Ga0068877_104588602 | 3300005525 | Freshwater Lake | MKKGTQAPAPMSKPVEGSKAGDKVTGGKVYQPFAGTPKPGKKVSK* |
| Ga0075470_100494012 | 3300006030 | Aqueous | MKKGTQAPAPMSKPVEGKKGGDKVQGGKVMAPFAGAAKPGKKVKKG* |
| Ga0070749_100007492 | 3300006802 | Aqueous | MKKGTQAPAPMSKPVEGKKEGDKVQGGKVMAPFAGAAKPGKKVKKG* |
| Ga0070749_104507422 | 3300006802 | Aqueous | MRRGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGAAKPGKKVKK* |
| Ga0075467_106542563 | 3300006803 | Aqueous | MKKGTQAAAPMSKPTEGAMGAQTKVSGGKVTIPFAGAPKPGKMVKKSK* |
| Ga0075473_102992873 | 3300006875 | Aqueous | RRGIKKRRCNMKKGTQAPAPMSKPVEGKREGDKVQGGKVMAPFAGAAKPGKKVKKG* |
| Ga0110929_100221312 | 3300008072 | Water Bodies | MRKGTQAPAPMSKPKEGAMGETTKVSGGKVMAPYAGAAKPGKKVKK* |
| Ga0105105_102016103 | 3300009009 | Freshwater Sediment | MKKGTHAPGTMAKPTEGAMGAITKVTGGKVEQPFAGKAKPGKKVKK* |
| Ga0105098_100932462 | 3300009081 | Freshwater Sediment | MKKGTQAPASMSKPVEGSKAGSVVTGGKVMVPFAGTPKPGKKVSK* |
| Ga0105099_100123013 | 3300009082 | Freshwater Sediment | MKKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGTPKPGTMVKKKK* |
| Ga0114962_100020586 | 3300009151 | Freshwater Lake | MNKGTQAPATYKKPDEGSKEGSVVTGGKVFQPFAGAAKPGKKVKK* |
| Ga0114962_100040658 | 3300009151 | Freshwater Lake | MNKGSQAPAPMAKPIHGAAGAGAKVTGGDVKMPFAGAPKPGKAVKK* |
| Ga0114962_100044394 | 3300009151 | Freshwater Lake | MKKGTHAPAPMSKPVEGKKAGDKVSGGKVMAPFAGAAKPGNKVKKG* |
| Ga0114962_101098004 | 3300009151 | Freshwater Lake | MNKGSQAPAPMSKPIHGAAGAGAKVKGGDVKMPFAGAAKPGKMVKKGK* |
| Ga0114962_101631291 | 3300009151 | Freshwater Lake | MNKGSQAPAPFAKPIHGAAGAGAKVTGGDVKMPFAGAPKPGKAVKK* |
| Ga0114975_101240252 | 3300009164 | Freshwater Lake | MKKGTQAPAPMSKPVEGSKAGDKVSGGKVYQPFAGAAKPGKKVKK* |
| Ga0105097_101077243 | 3300009169 | Freshwater Sediment | MNKGSQAPAPMSKPIHGTAGAGAKVKGGKVEMPFAGAAKPGKKVKK* |
| Ga0114979_106573922 | 3300009180 | Freshwater Lake | MKKGTQAPASMSKPTEGAMGATTKVVGGKQMQPFAGAPKPGKKVKK* |
| Ga0114959_100046175 | 3300009182 | Freshwater Lake | MKKGTHAPASMSKPVEGKKAGDKVSGGKVMAPFAGAAKPGNKVKKG* |
| Ga0114974_100024186 | 3300009183 | Freshwater Lake | MNKGSQAPAPMSKPIHGAAGAGAKVTGGDVKMPFAGAPKPGKKVKK* |
| Ga0114974_100346064 | 3300009183 | Freshwater Lake | MNKGSQAPAPMSKPIHGASGAGAKVTGGDVKMPFAGAAKPGKMVKKGK* |
| Ga0114976_103919162 | 3300009184 | Freshwater Lake | MKKGTQAPASMSKPTEGAMGATTKVVGGKQMQPFAGAPKPGKPVKK* |
| Ga0114976_107094482 | 3300009184 | Freshwater Lake | MNKGSQAPAPMAKPIHGAAGAGAKVTGGKVEMPFAGAAKPGKKVKK* |
| Ga0127391_10004896 | 3300009450 | Meromictic Pond | MNKGSQAPAPMAKPIHGASGAGAKVTGGKVEMPFAGAAKPGKSVKK* |
| Ga0114964_100357712 | 3300010157 | Freshwater Lake | MKKGTQAPAPFSKPVEGSKEGSVQPAGKKLLPFAGAPKPGKKVKK* |
| Ga0129333_110204242 | 3300010354 | Freshwater To Marine Saline Gradient | MKKGTHAPAPMSKPVEGKKGGDKVQGGKVMAPFAGAAKPGKKVKKGK* |
| Ga0136551_10110412 | 3300010388 | Pond Fresh Water | MRKGTHAPASMAKPTEGAMGSAVKVTGGKVELPFAGAAKPGKKVKK* |
| Ga0133913_101021426 | 3300010885 | Freshwater Lake | MNKGSQAPAPMSKPVHGAAGAGAKVTGGDVKMPFAGAAKPGKMVKKGK* |
| Ga0133913_102767786 | 3300010885 | Freshwater Lake | MKKGTQAPAPFSKPVEGSKDGSVQPAGKKLLPFAGAPKPGKKVKK* |
| Ga0133913_107472783 | 3300010885 | Freshwater Lake | MNKGTQAPASMSKPTEGAMGATTKVSGGKVMAPFAGTPKPGKKVKK* |
| Ga0133913_111896932 | 3300010885 | Freshwater Lake | MKKGTQAPASMSKPVEGSKAGSVVTDGKVTIPFAGAPKPGKMVKK* |
| Ga0151516_1026240 | 3300011116 | Freshwater | MNKGSQAPAPMSKPIHGASGAGAKVTGGDVKQPFAGAAKPGKKVKK* |
| Ga0153698_148318 | 3300011335 | Freshwater | MKKGTQAPASMSKPTQGAMGSDTKVAGGKVTIPFAGAPKPGKKVKK* |
| Ga0120086_1003134 | 3300011738 | Mine Pit Pond | MKKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGAAKPGKKVKK* |
| Ga0157138_10160323 | 3300012352 | Freshwater | MKKGTHAPASMAKPTEGAMGSTTKVTGGKVEQPFAGKAKPGKKVKK* |
| Ga0157210_10046484 | 3300012665 | Freshwater | MNKGSQAPAPYSKPTEGAMGATVKVTGGKVTIPFAGAAKPGKAVKK* |
| Ga0136641_10147482 | 3300013286 | Freshwater | MNKGTQAPASMIKPIHGTAGAGAKVTGGEVKQPFAGAPKPGKMVKK* |
| Ga0134314_1024292 | 3300014711 | Surface Water | MKKGTQAPAPMSKPVEGKKTGDKVSGGKVMEPFMGAAKPGKKVKKG* |
| Ga0134315_10013312 | 3300014962 | Surface Water | MRKGTSPAAPMSKPVEGKKEGDKVQGGKVMAPFAGAAKPGKKVKKG* |
| Ga0134315_10128234 | 3300014962 | Surface Water | MKKGTQAPAPMAKPVEGKKEGDKVQGGKVMQPFMGAAKPGKKVKKG* |
| Ga0134315_10204092 | 3300014962 | Surface Water | MKKGTQAPAPMSKPVEGKKEGDKVSGGKVYQPFAGAAKPGKKVKKG* |
| Ga0134315_10288483 | 3300014962 | Surface Water | MKKGTQAPAPMSKPVEGSKAGDKVTGGKVMAPFAGAAKPGKKVKK* |
| Ga0134315_10741602 | 3300014962 | Surface Water | MKKGTQAPAPMAKPVEGKKEGDKVTGGKVYMGYAGAAKPGKKVKKG* |
| Ga0181344_10528623 | 3300017754 | Freshwater Lake | MNKGTQAPASMSKPTEGAMGATTTVSGGKVMAPFAGAPKPGTMVKKSK |
| Ga0181344_11422462 | 3300017754 | Freshwater Lake | MRRGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGAAKPGKKVKK |
| Ga0181355_10521663 | 3300017785 | Freshwater Lake | MNKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGAAKPGKKVKK |
| Ga0181355_10758393 | 3300017785 | Freshwater Lake | MKKGTHAPAPMSKPVEGSKAGDKVTGGKVYQPFAGTPKPGKKVSK |
| Ga0213920_10022358 | 3300021438 | Freshwater | MKKGTQAPAPMSKPVEGSKAGDKVSGGKVMAPFAGTAKPGTKVKK |
| Ga0213920_10146404 | 3300021438 | Freshwater | MKTGTQAPAPMSKPTQGAMGSATKVTGGKVTIPFAGTPKPGKMVKKSK |
| Ga0213920_10226313 | 3300021438 | Freshwater | MKKGTQAPAPMSKPVEGSKAGDKVSGGKVYIPFAGTPKPGKKVKK |
| Ga0213920_10260902 | 3300021438 | Freshwater | MKKGTQAPAPMSKPVEGSKAGDKVSGGKVMAPFAGAAKPGKKVKK |
| Ga0194048_101104512 | 3300021519 | Anoxic Zone Freshwater | MKKGTQAAAPMSKPTEGAMGAQTKVSGGKVTIPFAGAPKPGKMVKKSK |
| Ga0213921_10193684 | 3300021952 | Freshwater | MKKGTQAAAPMSKPTQGAMGSATKVTGGKVTIPFAGTPKPGKMVKKSK |
| Ga0213922_10484433 | 3300021956 | Freshwater | MRKGTHAPASMAMPVEGKKEGDKVQGGKVMEPFAGAAKPGKKVKKG |
| Ga0228703_10373964 | 3300022747 | Freshwater | MRKGTQAPASMAKPVEGKKEGDKVQGGKVMAPFAGAAKPGKKVKKG |
| Ga0214917_100020565 | 3300022752 | Freshwater | MRKGTHAPASMAKPVEGKKEGDKVQGGKVMEPFAGAAKPGKKVKKG |
| Ga0214921_101916833 | 3300023174 | Freshwater | MKKGTQAPASMSKPTEGAMGATTKVVGGKQMQPFAGAPKPGKKVKK |
| Ga0214919_100063617 | 3300023184 | Freshwater | MKKGTQAPASFSKPTEGAMGSTTKVSGGKVTIPFAGAPKPGKMVKKSK |
| Ga0255147_10003444 | 3300024289 | Freshwater | MKKGTQAPAPMSKPVEGKKSGDKVQGGKVMAPFAGAAKPGKKVKKG |
| Ga0255175_11016863 | 3300024509 | Freshwater | KKGTQAPAPMSKPVEGKKSGDKVQGGKVMAPFAGAAKPGKKVKKG |
| Ga0255288_10774222 | 3300024561 | Freshwater | MKKGTQAPAPMSKPVEGKREGDKVQGGKVMAPFAGTAKPGKK |
| Ga0256337_11812312 | 3300024573 | Freshwater | MKKGTQAPAPMSKPVEGKKSGDKVQGGKVMAPFAGAAKPGKKV |
| Ga0208613_10115834 | 3300025616 | Freshwater | MKKGTQAAAPMSKPTEGAMGSATKVSGGKVTIPFAGAPKPGKMVKKSK |
| Ga0255289_11619031 | 3300026571 | Freshwater | MKKGTQAPAPMSKPVEGKKSGDKVQGGKVMAPFAGAAKPGKKVK |
| Ga0209704_10938812 | 3300027693 | Freshwater Sediment | MNKGTQAPASMSKPVEGSKAGSVVTGGKVMVPFAGTPKPGKKVKK |
| Ga0209188_100066312 | 3300027708 | Freshwater Lake | MNKGSQAPAPMSKPIHGAAGAGAKVKGGDVKMPFAGAAKPGKMVKKGK |
| Ga0209188_10016516 | 3300027708 | Freshwater Lake | MNKGTQAPATYKKPDEGSKEGSVVTGGKVFQPFAGAAKPGKKVKK |
| Ga0209188_10088434 | 3300027708 | Freshwater Lake | MKKGTHAPASMSKPVEGKKAGDKVSGGKVMAPFAGAAKPGNKVKKG |
| Ga0209188_10538004 | 3300027708 | Freshwater Lake | MNKGSQAPAPFAKPIHGAAGAGAKVTGGDVKMPFAGAPKPGKAVKK |
| Ga0209499_13285911 | 3300027712 | Freshwater Lake | MNKGSQAPAPMAKPIHGAAGAGAKVTGGDVKMPFAGAPKPGKAVKK |
| Ga0209087_10016717 | 3300027734 | Freshwater Lake | MNKGSQAPAPMSKPIHGASGAGAKVTGGDVKMPFAGAAKPGKMVKKSK |
| Ga0209087_10071435 | 3300027734 | Freshwater Lake | MNKGSQAPAPMSKPIHGASGAGAKVTGGDVKMPFAGAAKPGKMVKKGK |
| Ga0209084_10095802 | 3300027749 | Freshwater Lake | MNKGSQAPAPMSKPIHGAAGAGAKVTGGKVEMPFAGAAKPGKKVKK |
| Ga0209296_100119724 | 3300027759 | Freshwater Lake | MNKGSQAPAPMSKPIHGAAGAGAKVTGGDVKMPFAGAPKPGKKVKK |
| Ga0209287_100134962 | 3300027792 | Freshwater Sediment | MKKGTQAPAPMSKPVEGSKAGDKVTGGKVYQPFAGTPKPGKKVSK |
| Ga0209287_100252384 | 3300027792 | Freshwater Sediment | MKKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGTPKPGTMVKKKK |
| Ga0209230_102705992 | 3300027836 | Freshwater And Sediment | MKKGTHAPASMSKPTEGAMGATTKVAGGKVEQPYTAAARPGKKVKK |
| Ga0209668_109773202 | 3300027899 | Freshwater Lake Sediment | MKKGTQAPAPMSKPVEGKKGGDKVQGGKVMAPFAGTAKPGKKVKKG |
| Ga0209191_10736893 | 3300027969 | Freshwater Lake | MKKGTQAPAPMSKPVEGSKAGDKVSGGKVYQPFAGAAKPGKKVKK |
| Ga0247723_10011296 | 3300028025 | Deep Subsurface Sediment | MKKGTQAPAPMSKPVEGSKAGDKVTGGKVYQPYAGTPRPGKKVSK |
| Ga0311366_116004332 | 3300030943 | Fen | MNKGSQAPAPMSKPIHGAAGAGAKVTGGDVKMPFAGAAKP |
| Ga0307379_111598852 | 3300031565 | Soil | MNKGSQAPAPMAKPIHGTAGAGSKVTGGDVKQPFAGAAKPGKKVKK |
| Ga0307376_109975552 | 3300031578 | Soil | MKKGTHAPAPMSKPVEGSKAGDKVTGGKVYQPFAGAAKPGKKVSK |
| Ga0315909_104229181 | 3300031857 | Freshwater | KKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGTPKPGTMVKKKK |
| Ga0302322_1039994022 | 3300031902 | Fen | MNKGSQAAAPMSKPVHGAAGAGAKVKGGDVKMPFAGAAKPGKMVKKSK |
| Ga0334996_0281891_484_621 | 3300033994 | Freshwater | MKKGTQAPASMSKPVEGSKAGSVVTGGKVMAPFAGAPKPGKSVKK |
| Ga0334987_0390729_107_247 | 3300034061 | Freshwater | MKKGTQAPAPMSKPIHGTAGAGAKVTGGDVKQPYAGAAKPGKKVKK |
| ⦗Top⦘ |