Basic Information | |
---|---|
Taxon OID | 3300011593 Open in IMG/M |
Scaffold ID | Ga0122758_100236 Open in IMG/M |
Source Dataset Name | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway wood -P00382 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Weill Cornell Medical College |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 14540 |
Total Scaffold Genes | 19 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (57.89%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. JS42 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → City → Subway → Unclassified → City Subway Wood → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA:New York City | |||||||
Coordinates | Lat. (o) | 40.68 | Long. (o) | -73.96 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069722 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0122758_10023616 | F069722 | AGG | MRVRLTAELDPKAKRERPDMDKGAAHEKALGHESGAALQE* |
⦗Top⦘ |