Scaffold Ga0137936_1025584

Overview

Basic Information

• Taxon OID: 3300010933
• Scaffold ID: Ga0137936_1025584
• Source Dataset Name: Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_1383E
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 673
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge.

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean
• Coordinates
  • Lat. (^o): 22.8
  • Long. (^o): -46.05
  • Depth (m): 4425

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093968	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137936_10255842	F093968	AGGAG	MTRRAGLPRFSARSVRRGDAGHRKACATPSESLGKP