| Basic Information | |
|---|---|
| Taxon OID | 3300010933 Open in IMG/M |
| Scaffold ID | Ga0137936_1023158 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_1383E |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 702 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 22.8 | Long. (o) | -46.05 | Alt. (m) | Depth (m) | 4425 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093968 | Metagenome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137936_10231583 | F093968 | AGGAG | MTHRDGLPRFSALSVRCGDAGHREACATPSESLGKPPFRSRMRPVGG |
| ⦗Top⦘ |