| Basic Information | |
|---|---|
| Taxon OID | 3300010406 Open in IMG/M |
| Scaffold ID | Ga0136844_1130 Open in IMG/M |
| Source Dataset Name | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - Middle of the channel P4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Illumina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 510 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canaa dos Carajas, PA, Brazil | |||||||
| Coordinates | Lat. (o) | -6.42916667 | Long. (o) | -50.06611111 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F100042 | Metagenome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136844_11302 | F100042 | N/A | KVEMARPTGVGRALATYEIPIEGRDAWLAAARRQV* |
| ⦗Top⦘ |