3300010406: Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - Middle of the channel P4

Overview

Basic Information

• IMG/M Taxon OID: 3300010406
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121456 | Gp0155391 | Ga0136844
• Sample Name: Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - Middle of the channel P4
• Sequencing Status: Permanent Draft
• Sequencing Center: Illumina
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 273974
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → mine → contaminated soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Canaa dos Carajas, PA, Brazil
• Coordinates
  • Lat. (^o): -6.42916667
  • Long. (^o): -50.06611111
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100042	Metagenome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0136844_1130	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus	510

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136844_1130	Ga0136844_11302	F100042	KVEMARPTGVGRALATYEIPIEGRDAWLAAARRQV*