| Basic Information | |
|---|---|
| Family ID | F100042 |
| Family Type | Metagenome |
| Number of Sequences | 103 |
| Average Sequence Length | 38 residues |
| Representative Sequence | AVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.07 % |
| % of genes near scaffold ends (potentially truncated) | 86.41 % |
| % of genes from short scaffolds (< 2000 bps) | 82.52 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.408 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (17.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.417 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.252 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.74% β-sheet: 0.00% Coil/Unstructured: 82.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF02909 | TetR_C_1 | 10.68 |
| PF00196 | GerE | 8.74 |
| PF00126 | HTH_1 | 7.77 |
| PF13602 | ADH_zinc_N_2 | 4.85 |
| PF14329 | DUF4386 | 3.88 |
| PF00005 | ABC_tran | 2.91 |
| PF00795 | CN_hydrolase | 1.94 |
| PF08281 | Sigma70_r4_2 | 1.94 |
| PF13518 | HTH_28 | 1.94 |
| PF00392 | GntR | 0.97 |
| PF13411 | MerR_1 | 0.97 |
| PF00058 | Ldl_recept_b | 0.97 |
| PF01048 | PNP_UDP_1 | 0.97 |
| PF00160 | Pro_isomerase | 0.97 |
| PF00563 | EAL | 0.97 |
| PF00248 | Aldo_ket_red | 0.97 |
| PF13229 | Beta_helix | 0.97 |
| PF07883 | Cupin_2 | 0.97 |
| PF08240 | ADH_N | 0.97 |
| PF10604 | Polyketide_cyc2 | 0.97 |
| PF03060 | NMO | 0.97 |
| PF00903 | Glyoxalase | 0.97 |
| PF04542 | Sigma70_r2 | 0.97 |
| PF00440 | TetR_N | 0.97 |
| PF00383 | dCMP_cyt_deam_1 | 0.97 |
| PF00107 | ADH_zinc_N | 0.97 |
| PF13412 | HTH_24 | 0.97 |
| PF13426 | PAS_9 | 0.97 |
| PF13847 | Methyltransf_31 | 0.97 |
| PF05117 | DUF695 | 0.97 |
| PF00072 | Response_reg | 0.97 |
| PF00773 | RNB | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 10.68 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.97 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.97 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.97 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.97 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.97 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.97 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.97 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.97 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.97 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.97 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.97 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.97 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.97 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.97 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.41 % |
| Unclassified | root | N/A | 13.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725009|PermFrostAlaska_NODE_395_len_3744_cov_32_235577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3794 | Open in IMG/M |
| 2124908032|Perma_A_C_ConsensusfromContig177445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14 | 618 | Open in IMG/M |
| 2124908041|P3_CLC_ConsensusfromContig51473 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300001402|JGI20195J14853_1048531 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300001538|A10PFW1_10398348 | Not Available | 1636 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10247565 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10036862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2170 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10037938 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300005367|Ga0070667_100022038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5286 | Open in IMG/M |
| 3300005543|Ga0070672_100043580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3461 | Open in IMG/M |
| 3300005549|Ga0070704_100015738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4761 | Open in IMG/M |
| 3300005836|Ga0074470_11385922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 892 | Open in IMG/M |
| 3300009029|Ga0066793_10491149 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300009029|Ga0066793_10499902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 695 | Open in IMG/M |
| 3300009098|Ga0105245_11612028 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009098|Ga0105245_13070821 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010041|Ga0126312_10453001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 915 | Open in IMG/M |
| 3300010045|Ga0126311_11319505 | Not Available | 600 | Open in IMG/M |
| 3300010403|Ga0134123_10237106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1578 | Open in IMG/M |
| 3300010406|Ga0136844_1130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus | 510 | Open in IMG/M |
| 3300011994|Ga0120157_1024174 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300012001|Ga0120167_1068570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 752 | Open in IMG/M |
| 3300012001|Ga0120167_1085231 | Not Available | 655 | Open in IMG/M |
| 3300012001|Ga0120167_1125397 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012091|Ga0136625_1051010 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300012206|Ga0137380_11689855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300012529|Ga0136630_1204253 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012530|Ga0136635_10341809 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012678|Ga0136615_10057243 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300012679|Ga0136616_10322567 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012912|Ga0157306_10133613 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300013758|Ga0120147_1050355 | Not Available | 730 | Open in IMG/M |
| 3300013772|Ga0120158_10050176 | All Organisms → cellular organisms → Bacteria | 2896 | Open in IMG/M |
| 3300014259|Ga0075311_1151139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 532 | Open in IMG/M |
| 3300014304|Ga0075340_1068072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 659 | Open in IMG/M |
| 3300014322|Ga0075355_1054319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 904 | Open in IMG/M |
| 3300014502|Ga0182021_10482828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1476 | Open in IMG/M |
| 3300014502|Ga0182021_13724569 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300014823|Ga0120170_1022660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1725 | Open in IMG/M |
| 3300015165|Ga0167628_1042713 | Not Available | 949 | Open in IMG/M |
| 3300015373|Ga0132257_100881742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1121 | Open in IMG/M |
| 3300018060|Ga0187765_10133304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1387 | Open in IMG/M |
| 3300018433|Ga0066667_11361426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300019875|Ga0193701_1067030 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300020021|Ga0193726_1318933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 591 | Open in IMG/M |
| 3300021078|Ga0210381_10051468 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300021339|Ga0193706_1030418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1602 | Open in IMG/M |
| 3300021363|Ga0193699_10001401 | All Organisms → cellular organisms → Bacteria | 9559 | Open in IMG/M |
| 3300021602|Ga0194060_10359916 | Not Available | 706 | Open in IMG/M |
| 3300022534|Ga0224452_1115235 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300022694|Ga0222623_10173846 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300024245|Ga0247677_1023247 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300025533|Ga0208584_1090188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 744 | Open in IMG/M |
| 3300025692|Ga0209744_1102882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 979 | Open in IMG/M |
| 3300025692|Ga0209744_1127618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300025739|Ga0209745_1061244 | Not Available | 1361 | Open in IMG/M |
| 3300025764|Ga0209539_1148766 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 905 | Open in IMG/M |
| 3300025836|Ga0209748_1079400 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300025857|Ga0209014_10067516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1492 | Open in IMG/M |
| 3300025857|Ga0209014_10188646 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300025864|Ga0209429_10385767 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300025865|Ga0209226_10057798 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300025865|Ga0209226_10132129 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300025865|Ga0209226_10279219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 708 | Open in IMG/M |
| 3300025865|Ga0209226_10381153 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300025885|Ga0207653_10002634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5695 | Open in IMG/M |
| 3300025888|Ga0209540_10055647 | Not Available | 2439 | Open in IMG/M |
| 3300025904|Ga0207647_10021097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4354 | Open in IMG/M |
| 3300025941|Ga0207711_11987541 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026075|Ga0207708_10019678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5091 | Open in IMG/M |
| 3300027773|Ga0209810_1261891 | Not Available | 661 | Open in IMG/M |
| 3300028784|Ga0307282_10032374 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300028802|Ga0307503_10021310 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
| 3300028802|Ga0307503_10290857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 815 | Open in IMG/M |
| 3300028803|Ga0307281_10445994 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300028811|Ga0307292_10325254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300028824|Ga0307310_10729578 | Not Available | 509 | Open in IMG/M |
| 3300028861|Ga0302259_1086156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
| 3300029987|Ga0311334_10523715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 955 | Open in IMG/M |
| 3300029990|Ga0311336_10889167 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300030294|Ga0311349_10464571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1197 | Open in IMG/M |
| 3300031511|Ga0307424_1151084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 734 | Open in IMG/M |
| 3300031699|Ga0315535_1121994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter → Modestobacter excelsi | 957 | Open in IMG/M |
| 3300031707|Ga0315291_10926977 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300032053|Ga0315284_11212120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 828 | Open in IMG/M |
| 3300032156|Ga0315295_10908726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium | 878 | Open in IMG/M |
| 3300032163|Ga0315281_10527114 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300032173|Ga0315268_10038345 | All Organisms → cellular organisms → Bacteria | 4588 | Open in IMG/M |
| 3300032177|Ga0315276_12042393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 584 | Open in IMG/M |
| 3300032276|Ga0316188_10877777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 500 | Open in IMG/M |
| 3300032342|Ga0315286_11293834 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300032397|Ga0315287_11026042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 959 | Open in IMG/M |
| 3300032397|Ga0315287_12385958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 571 | Open in IMG/M |
| 3300033004|Ga0335084_10487815 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300033233|Ga0334722_10582804 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300033482|Ga0316627_101898825 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300033489|Ga0299912_11027590 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300034125|Ga0370484_0037692 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300034818|Ga0373950_0047443 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 17.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.59% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.71% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 8.74% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.88% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.94% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.94% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.94% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.97% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.97% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.97% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.97% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.97% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.97% |
| Wetland Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.97% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725009 | Permafrost microbial communities from central Alaska, USA - Permafrost field sample | Environmental | Open in IMG/M |
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
| 3300003473 | Fe-reducing enrichment culture from wetland. Sample 3 with anaerobic and aerobic cycling. | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010406 | Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - Middle of the channel P4 | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015165 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3A, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026047 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031511 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-20 | Environmental | Open in IMG/M |
| 3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| draft_perm_00096110 | 2067725009 | Permafrost | EAVMARPTGVGRAISTCTIPIEGRDEWLAAARRLA |
| Perma_A_C_01705140 | 2124908032 | Soil | LALPEAVMARPTGFGRPITTYTIPIQDREEWEAAARESLA |
| P3_CLC_01194250 | 2124908041 | Soil | LLPEKVEMARPTGVGHALTAYRMPIEGRDEWIAAAGRRLA |
| JGI20195J14853_10485313 | 3300001402 | Arctic Peat Soil | VVARPTGVGSALTAYDMPIEGRDEWVAAVARLMA* |
| A10PFW1_103983481 | 3300001538 | Permafrost | TTQQVFVARPTGVGRAITAYDMPIDGRDEWLAAAARHLA* |
| JGIcombinedJ21913_102475651 | 3300002068 | Arctic Peat Soil | KEWVXARPTGVGRALTAYRMPIEGRDEWIAAVERLA* |
| JGIcombinedJ21915_100368623 | 3300002071 | Arctic Peat Soil | AVMARPTGVGRALTAYRMPIEGRDEWIAAVERLA* |
| JGIcombinedJ21914_100379381 | 3300002072 | Arctic Peat Soil | SGDLARPEGAGRALATFEIPIEGRDEWLAAARRLA* |
| FeGluAir_105560791 | 3300003473 | Wetland Sediment | VSPMSRLKTLARPTGVGSALTAYGMPIEGRDEWLAAVARLLA* |
| Ga0070667_1000220381 | 3300005367 | Switchgrass Rhizosphere | VGHEAHGMAPPVTGVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA* |
| Ga0070672_1000435806 | 3300005543 | Miscanthus Rhizosphere | ALPTKVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA* |
| Ga0070704_1000157387 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LALPTKVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA* |
| Ga0074470_113859223 | 3300005836 | Sediment (Intertidal) | APPEKVAMARPTGVGRAITAYDMPIDGRDEWVAAARRLA* |
| Ga0066793_104911491 | 3300009029 | Prmafrost Soil | VDMARSTGVGRAITTYDMPIEGRDEWLAAVERLA* |
| Ga0066793_104999023 | 3300009029 | Prmafrost Soil | EQVFVARPTGVGSAIATYDMPIEGRDEWLAAAARHFA* |
| Ga0105245_116120282 | 3300009098 | Miscanthus Rhizosphere | ALPEKVGLARPTGVGRALATYEIPIEGRDEWLAAARRLA* |
| Ga0105245_130708211 | 3300009098 | Miscanthus Rhizosphere | EAVMARPTGVGRAISTYTIPIEGRDEWLAAARLGA* |
| Ga0126312_104530012 | 3300010041 | Serpentine Soil | MASPILARPTGVGRALATYEIPIEGRDEWLAAARRLA* |
| Ga0126311_113195053 | 3300010045 | Serpentine Soil | MSYDTGRVVMARPTGVGRALTTHDILIERRDEWLAAARRLA* |
| Ga0134123_102371064 | 3300010403 | Terrestrial Soil | MALPVTGVMARPTGVGRTISTYTIPIEGRDEWLAAARRLA* |
| Ga0136844_11302 | 3300010406 | Soil | KVEMARPTGVGRALATYEIPIEGRDAWLAAARRQV* |
| Ga0120157_10241741 | 3300011994 | Permafrost | VFVALPTGVGRALATYEIPIEGRDEWLGAARGLAGGLA |
| Ga0120167_10685702 | 3300012001 | Permafrost | PEKVVMARPTGVGHALTAYRMPIEGRDEWIAAARRLA* |
| Ga0120167_10852312 | 3300012001 | Permafrost | QQVFVARPTGAGRAITAYDMPIDGRDEWLAAAARHLA* |
| Ga0120167_11253971 | 3300012001 | Permafrost | FVMARPTGVGRAITTYNMPIDGRDEWLAAAARHLA* |
| Ga0136625_10510104 | 3300012091 | Polar Desert Sand | EKVAMARPTGVGRALTAYRMPIEGRDEWLASVERLA* |
| Ga0137380_116898551 | 3300012206 | Vadose Zone Soil | VAFVRPSGLGRAISTFDIPIEGRDEWLAAARRLA* |
| Ga0136630_12042532 | 3300012529 | Polar Desert Sand | ALPEKVEMARPTGVGHALTAYRMPIEGRDEWIAAAGRRLA* |
| Ga0136635_103418091 | 3300012530 | Polar Desert Sand | KVEMARPTGVGRALTAFHIPIEGRDEWIAAARRLA* |
| Ga0136615_100572431 | 3300012678 | Polar Desert Sand | SPGLVRRVKAAITRPTGVGSATTAISMPIEGRDEWLAAARRLA* |
| Ga0136616_103225673 | 3300012679 | Polar Desert Sand | PDAVMARLTGVGRAITTYDMPIEGRDEWLAAARRLA* |
| Ga0157306_101336131 | 3300012912 | Soil | REMARPIGVGRAISTYTIPIEGRDEWLAAARRLA* |
| Ga0120147_10503551 | 3300013758 | Permafrost | VQPAQEWVLARPTGLGTTITTYEIPIEGRDEWLAAARQLA* |
| Ga0120158_100501761 | 3300013772 | Permafrost | QQVFVARPTGVGRAITAYDMPIDGRDEWLAAAARHLA* |
| Ga0075311_11511392 | 3300014259 | Natural And Restored Wetlands | MALACPTGVGRAIATYEIPIEGRDEWLAAARRLA* |
| Ga0075340_10680721 | 3300014304 | Natural And Restored Wetlands | LALPEKVELARPTGVGRALATYEILIEGRAEWLAAARRLA* |
| Ga0075355_10543193 | 3300014322 | Natural And Restored Wetlands | LALPEKVVLARPTGVGSALTAYGMPIEGRDEWLAAVARLLA* |
| Ga0182021_104828281 | 3300014502 | Fen | LPEKVAVARPTGVGRAITTYDMPIEGRDEWVAAARRLA* |
| Ga0182021_137245691 | 3300014502 | Fen | RWGVMARPTGVGRALTAYRMPIEGRDEWIAAVERLA* |
| Ga0120170_10226601 | 3300014823 | Permafrost | AEARVWVARPEGVGRALATYRVPIEGRDEWIAAAERLA* |
| Ga0167628_10427132 | 3300015165 | Glacier Forefield Soil | GRRALFVVSKPMPVGRALATFEIPIEGRDEWLAAARRLA* |
| Ga0132257_1008817423 | 3300015373 | Arabidopsis Rhizosphere | AVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA* |
| Ga0187765_101333041 | 3300018060 | Tropical Peatland | LVEVARPAGFGHALATCEIPIEGRDEWLAAAGLSA |
| Ga0066667_113614262 | 3300018433 | Grasslands Soil | MELPDKVEMARPTGVGRALATYTIPIEGRDEWLAAAGLRA |
| Ga0193701_10670303 | 3300019875 | Soil | PAQEWVLARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0193726_13189331 | 3300020021 | Soil | CPIRLKMARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0210381_100514683 | 3300021078 | Groundwater Sediment | PPLRLARPTGVGRAISTCTIPIEGRDEWLAAARRLA |
| Ga0193706_10304181 | 3300021339 | Soil | SRCPKRLKWRARQVVGRALATCEIPIEGRDEWLAAAGLTA |
| Ga0193699_100014016 | 3300021363 | Soil | MSRGGALARPTGVGGAIATYTIPIEGRDEWLAAARRLA |
| Ga0194060_103599161 | 3300021602 | Anoxic Zone Freshwater | TQADEMARPTGVGLALATCDLAIEGRDEWLAAARRLA |
| Ga0224452_11152351 | 3300022534 | Groundwater Sediment | EVAVARPTGVGRAISTCTIPIEGRDEWLAAARRLA |
| Ga0222623_101738461 | 3300022694 | Groundwater Sediment | PEEVAVARPTGVGRAISTCTIPIEGRDEWLAAARRLA |
| Ga0247677_10232471 | 3300024245 | Soil | KGVLARLTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0208584_10901881 | 3300025533 | Arctic Peat Soil | KEWVLARPTGVGRALTAYRMPIEGRDEWIAAVERLA |
| Ga0209744_11028823 | 3300025692 | Arctic Peat Soil | LALVLPQVVMARPTGVGHALTAYRMPIEGRDEWIAAVERLA |
| Ga0209744_11276181 | 3300025692 | Arctic Peat Soil | RAIGHLARPTGVGSALTAYDMPIEGRDEWLAAVARLLA |
| Ga0209745_10612442 | 3300025739 | Arctic Peat Soil | SPVARSKGVGRAIAAYDMLIEGRDEWLAAAARHLA |
| Ga0209539_11487661 | 3300025764 | Arctic Peat Soil | ALPEKVEMARPTGVGRGITTYTIPIDGRDEWLAAARRLA |
| Ga0209748_10794001 | 3300025836 | Arctic Peat Soil | EVVMARPTGVGRAITAYDMPIEGRDEWLAAAARHFA |
| Ga0209014_100675164 | 3300025857 | Arctic Peat Soil | LAMPEKVAMARPTGVGRALTAYRMPIEGRDEWIAAVERLA |
| Ga0209014_101886461 | 3300025857 | Arctic Peat Soil | EQVFVARPTGVGRALTAYRMPIEGRDEWIAAVERLA |
| Ga0209429_103857671 | 3300025864 | Arctic Peat Soil | AAMARPTGVGRAIPTYDMPIEGRDEWLAAAARHLA |
| Ga0209226_100577981 | 3300025865 | Arctic Peat Soil | RKRAALARPEGAGRALATCEIPIEGRDEWVAAARRLA |
| Ga0209226_101321293 | 3300025865 | Arctic Peat Soil | LPEIVVSVRPTSVGHALTTCTILIEGRDEWIAAAGERSA |
| Ga0209226_102792193 | 3300025865 | Arctic Peat Soil | VLPEQAAMARPTGVGRAITAYDMPIEGRDEWLAAAARHFA |
| Ga0209226_103811531 | 3300025865 | Arctic Peat Soil | LALPDAVMARPTGVGHALTAYRMPIEGRDEWIAAVERLA |
| Ga0207653_100026341 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVTGVMARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0209540_100556474 | 3300025888 | Arctic Peat Soil | AMPDKVAMARPTGVGHALTAYRMPIEGRAEWIAAVERLA |
| Ga0207647_100210971 | 3300025904 | Corn Rhizosphere | VLPEKVAVARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0207711_119875411 | 3300025941 | Switchgrass Rhizosphere | ERVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0208658_10221861 | 3300026047 | Natural And Restored Wetlands | VSLMSRLMTLARPTGVGHAISTYTIPIDGRDEWIAAARRQA |
| Ga0207708_100196788 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | AIGFSRSRDALARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0209810_12618911 | 3300027773 | Surface Soil | PMAWRARTGVGRALATYEIPIEGPDECLAAARRLA |
| Ga0307282_100323742 | 3300028784 | Soil | MTSELRMRQKVAMARPTGVGRALATYTIPIEGRDEWLAAARRLA |
| Ga0307503_100213101 | 3300028802 | Soil | TEVALARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0307503_102908571 | 3300028802 | Soil | KKCHGAPTGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0307281_104459941 | 3300028803 | Soil | TFVLARPTGVGRAITAYRMPIEGRDEWVAAARRLA |
| Ga0307292_103252542 | 3300028811 | Soil | PGARVIVVLARPTGVGRAITTYSIPIEGRDEWIAAAERLA |
| Ga0307310_107295782 | 3300028824 | Soil | MVNRERRPSSVLARPTGVGRAISTYTISIEGRDEWLAAAG |
| Ga0302259_10861562 | 3300028861 | Fen | KVAVARPTGVGRALATCEIPIEGRDEWLAAAWLATA |
| Ga0311334_105237151 | 3300029987 | Fen | LALPQAVMARPTGVRRAIATCEIPIEGRDEWLAAARRLA |
| Ga0311336_108891672 | 3300029990 | Fen | MKAGILARPTGVGPAISTYNIPIEGRDEWLAAAGLPA |
| Ga0311349_104645712 | 3300030294 | Fen | RWRCPKIVAMARPTGGGRAISTYELLIEGRDEWLAAARRLA |
| Ga0299906_106004453 | 3300030606 | Soil | TLPEAVMSRLMTMARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0302046_101348841 | 3300030620 | Soil | VSPMSRLMTMARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| Ga0307424_11510842 | 3300031511 | Salt Marsh | LARPTVARPTGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0315535_11219941 | 3300031699 | Salt Marsh Sediment | TSVLARPTGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0315291_109269773 | 3300031707 | Sediment | LHDGLARPEGSGRALATCEIPIEGRDEWIAAAEGWA |
| Ga0315284_112121201 | 3300032053 | Sediment | PQVVMARPEGFGRALATYELPIEGRDEWLAAARRLA |
| Ga0315295_109087261 | 3300032156 | Sediment | RRNLARPEGSGRALATYEVPIEGRDEWIAAARHLA |
| Ga0315281_105271141 | 3300032163 | Sediment | ALPEKAVLARPTGVGHALTAYEIPIEGRDEWLAAARRRA |
| Ga0315268_100383451 | 3300032173 | Sediment | LPRQVEMARLTGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0315276_120423932 | 3300032177 | Sediment | PERVVMARPEGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0316188_108777771 | 3300032276 | Worm Burrow | PDKVAVARPEDVGRAIATYEIPIEGRDEWLTAAGIVGA |
| Ga0315286_112938342 | 3300032342 | Sediment | LPEEGVMARPTGVGRAITTCSMSIEGRDEWLAAAVRHLA |
| Ga0315287_110260421 | 3300032397 | Sediment | LPERVVMARPEGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0315287_123859582 | 3300032397 | Sediment | TDVLARPTGVGRALATYEIPIEGRDEWLAAARRLA |
| Ga0335084_104878152 | 3300033004 | Soil | MERMSMARPTGVGRAISTYTIPIEGRDEWLAAARLLA |
| Ga0334722_105828043 | 3300033233 | Sediment | LPEAVMARPTGVGRAITTYTLPIEGRDEWLVAAGRRA |
| Ga0316627_1018988253 | 3300033482 | Soil | KVEMARPTGVGRAISTCTIPIEGRDEWLAAARRLA |
| Ga0299912_110275903 | 3300033489 | Soil | RTFDLETMALARPTGVGHALTTHRIPIEGRNEWIAAARRLA |
| Ga0370484_0037692_1043_1168 | 3300034125 | Untreated Peat Soil | ALARPGPVVMARLTGVGRAISTCTIPIEGRDEWLAAARRLA |
| Ga0373950_0047443_718_837 | 3300034818 | Rhizosphere Soil | ELPEEVVLARPTGVGRAISTYTIPIEGRDEWLAAARRLA |
| ⦗Top⦘ |