Scaffold Ga0129317_1048658

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129317_1048658

Scaffold Ga0129317_1048658

Overview

Basic Information
Taxon OID	3300010262 Open in IMG/M
Scaffold ID	Ga0129317_1048658 Open in IMG/M
Source Dataset Name	Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm1105 metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	699
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.07	Long. (^o)	-89.4	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129317_10486582	F051936	N/A	QEGTGQVLFFPLALRGKAFGFSVLQEHAVMTPVISIFFETLIIKYLSIQISIKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.