Scaffold Ga0129317_1023540

Overview

Basic Information

• Taxon OID: 3300010262
• Scaffold ID: Ga0129317_1023540
• Source Dataset Name: Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm1105 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1260
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides fragilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.07
  • Long. (^o): -89.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129317_10235401	F051936	N/A	QVLFFPLALRGKAFGFSVLQENAVMTPVISIFFVMLMIRYLSIHISIKK*